SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86X76

- NIT1_HUMAN

UniProt

Q86X76 - NIT1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nitrilase homolog 1

Gene
NIT1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2 By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei86 – 861Proton acceptor By similarity
Active sitei161 – 1611Proton donor By similarity
Active sitei203 – 2031Nucleophile By similarity

GO - Molecular functioni

  1. nitrilase activity Source: ProtInc

GO - Biological processi

  1. nitrogen compound metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BRENDAi3.5.5.1. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Nitrilase homolog 1 (EC:3.5.-.-)
Gene namesi
Name:NIT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:7828. NIT1.

Subcellular locationi

Cytoplasm. Mitochondrion By similarity

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. mitochondrion Source: UniProtKB-SubCell
  3. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31636.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 327327Nitrilase homolog 1PRO_0000213251Add
BLAST

Proteomic databases

MaxQBiQ86X76.
PaxDbiQ86X76.
PRIDEiQ86X76.

PTM databases

PhosphoSiteiQ86X76.

Expressioni

Tissue specificityi

Detected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

ArrayExpressiQ86X76.
BgeeiQ86X76.
CleanExiHS_NIT1.
GenevestigatoriQ86X76.

Organism-specific databases

HPAiHPA006657.

Interactioni

Protein-protein interaction databases

BioGridi110882. 4 interactions.
IntActiQ86X76. 2 interactions.
MINTiMINT-1194030.
STRINGi9606.ENSP00000356988.

Structurei

3D structure databases

ProteinModelPortaliQ86X76.
SMRiQ86X76. Positions 48-319.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 320274CN hydrolaseAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0388.
HOGENOMiHOG000222700.
HOVERGENiHBG052628.
InParanoidiQ86X76.
KOiK01506.
OMAiSTPDKEQ.
OrthoDBiEOG7XDBGD.
PhylomeDBiQ86X76.
TreeFamiTF313080.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR003010. C-N_Hydrolase.
IPR001110. UPF0012_CS.
[Graphical view]
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
PS01227. UPF0012. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q86X76-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLGFITRPPH RFLSLLCPGL RIPQLSVLCA QPRPRAMAIS SSSCELPLVA    50
VCQVTSTPDK QQNFKTCAEL VREAARLGAC LAFLPEAFDF IARDPAETLH 100
LSEPLGGKLL EEYTQLAREC GLWLSLGGFH ERGQDWEQTQ KIYNCHVLLN 150
SKGAVVATYR KTHLCDVEIP GQGPMCESNS TMPGPSLESP VSTPAGKIGL 200
AVCYDMRFPE LSLALAQAGA EILTYPSAFG SITGPAHWEV LLRARAIETQ 250
CYVVAAAQCG RHHEKRASYG HSMVVDPWGT VVARCSEGPG LCLARIDLNY 300
LRQLRRHLPV FQHRRPDLYG NLGHPLS 327

Note: Major isoform.

Length:327
Mass (Da):35,896
Last modified:August 31, 2004 - v2
Checksum:i90F7FB9D4BA627B1
GO
Isoform 1 (identifier: Q86X76-2) [UniParc]FASTAAdd to Basket

Also known as: 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:291
Mass (Da):31,859
Checksum:i314677E205F7ADDE
GO
Isoform 4 (identifier: Q86X76-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQ → MVLAISSCWA...PGRTYSLSRR
     327-327: S → SDLTSVSLDLPLPPPPCHYELVLM

Show »
Length:367
Mass (Da):40,200
Checksum:i178F0C4BBFE65D25
GO
Isoform 5 (identifier: Q86X76-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPR → MTFGLRKRLSEERGFSLM

Show »
Length:312
Mass (Da):34,323
Checksum:iA0BFFE4B76D24EE0
GO
Isoform 6 (identifier: Q86X76-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-243: VLLR → PVSS
     244-327: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a NIT1-DEDD fusion protein. The last 4 amino acids of this isoform (PVSS) are encoded by the last DEDD exon. No experimental confirmation available.

Show »
Length:243
Mass (Da):26,326
Checksum:i283B9E8D6A4EF67D
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636Missing in isoform 1. VSP_011546Add
BLAST
Alternative sequencei1 – 3333MLGFI…CAQPR → MTFGLRKRLSEERGFSLM in isoform 5. VSP_011545Add
BLAST
Alternative sequencei1 – 3131MLGFI…VLCAQ → MVLAISSCWASSPGLLTDSC PFCVLDSGYLNSQYFVLSPG RTYSLSRR in isoform 4. VSP_011544Add
BLAST
Alternative sequencei240 – 2434VLLR → PVSS in isoform 6. VSP_053711
Alternative sequencei244 – 32784Missing in isoform 6. VSP_053712Add
BLAST
Alternative sequencei327 – 3271S → SDLTSVSLDLPLPPPPCHYE LVLM in isoform 4. VSP_011547

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti79 – 791A → P in AAH46149. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF069984 Genomic DNA. Translation: AAC39901.1.
AF069987 mRNA. Translation: AAC39907.1.
CR541814 mRNA. Translation: CAG46613.1.
CR541846 mRNA. Translation: CAG46644.1.
AL591806 Genomic DNA. Translation: CAI15379.1.
CH471121 Genomic DNA. Translation: EAW52656.1.
CH471121 Genomic DNA. Translation: EAW52654.1.
CH471121 Genomic DNA. Translation: EAW52657.1.
BC046149 mRNA. Translation: AAH46149.1.
CCDSiCCDS1218.1. [Q86X76-1]
CCDS53401.1. [Q86X76-5]
CCDS53402.1. [Q86X76-4]
CCDS53403.1. [Q86X76-2]
RefSeqiNP_001172021.1. NM_001185092.1. [Q86X76-5]
NP_001172022.1. NM_001185093.1. [Q86X76-4]
NP_001172023.1. NM_001185094.1. [Q86X76-2]
NP_005591.1. NM_005600.2. [Q86X76-1]
XP_005245273.1. XM_005245216.2. [Q86X76-2]
UniGeneiHs.146406.

Genome annotation databases

EnsembliENST00000368007; ENSP00000356986; ENSG00000158793. [Q86X76-4]
ENST00000368008; ENSP00000356987; ENSG00000158793. [Q86X76-5]
ENST00000368009; ENSP00000356988; ENSG00000158793. [Q86X76-1]
ENST00000392190; ENSP00000376028; ENSG00000158793. [Q86X76-2]
GeneIDi4817.
KEGGihsa:4817.
UCSCiuc001fxv.2. human. [Q86X76-1]
uc010pka.2. human. [Q86X76-4]

Polymorphism databases

DMDMi51704324.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF069984 Genomic DNA. Translation: AAC39901.1 .
AF069987 mRNA. Translation: AAC39907.1 .
CR541814 mRNA. Translation: CAG46613.1 .
CR541846 mRNA. Translation: CAG46644.1 .
AL591806 Genomic DNA. Translation: CAI15379.1 .
CH471121 Genomic DNA. Translation: EAW52656.1 .
CH471121 Genomic DNA. Translation: EAW52654.1 .
CH471121 Genomic DNA. Translation: EAW52657.1 .
BC046149 mRNA. Translation: AAH46149.1 .
CCDSi CCDS1218.1. [Q86X76-1 ]
CCDS53401.1. [Q86X76-5 ]
CCDS53402.1. [Q86X76-4 ]
CCDS53403.1. [Q86X76-2 ]
RefSeqi NP_001172021.1. NM_001185092.1. [Q86X76-5 ]
NP_001172022.1. NM_001185093.1. [Q86X76-4 ]
NP_001172023.1. NM_001185094.1. [Q86X76-2 ]
NP_005591.1. NM_005600.2. [Q86X76-1 ]
XP_005245273.1. XM_005245216.2. [Q86X76-2 ]
UniGenei Hs.146406.

3D structure databases

ProteinModelPortali Q86X76.
SMRi Q86X76. Positions 48-319.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110882. 4 interactions.
IntActi Q86X76. 2 interactions.
MINTi MINT-1194030.
STRINGi 9606.ENSP00000356988.

PTM databases

PhosphoSitei Q86X76.

Polymorphism databases

DMDMi 51704324.

Proteomic databases

MaxQBi Q86X76.
PaxDbi Q86X76.
PRIDEi Q86X76.

Protocols and materials databases

DNASUi 4817.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000368007 ; ENSP00000356986 ; ENSG00000158793 . [Q86X76-4 ]
ENST00000368008 ; ENSP00000356987 ; ENSG00000158793 . [Q86X76-5 ]
ENST00000368009 ; ENSP00000356988 ; ENSG00000158793 . [Q86X76-1 ]
ENST00000392190 ; ENSP00000376028 ; ENSG00000158793 . [Q86X76-2 ]
GeneIDi 4817.
KEGGi hsa:4817.
UCSCi uc001fxv.2. human. [Q86X76-1 ]
uc010pka.2. human. [Q86X76-4 ]

Organism-specific databases

CTDi 4817.
GeneCardsi GC01P161087.
HGNCi HGNC:7828. NIT1.
HPAi HPA006657.
MIMi 604618. gene.
neXtProti NX_Q86X76.
PharmGKBi PA31636.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0388.
HOGENOMi HOG000222700.
HOVERGENi HBG052628.
InParanoidi Q86X76.
KOi K01506.
OMAi STPDKEQ.
OrthoDBi EOG7XDBGD.
PhylomeDBi Q86X76.
TreeFami TF313080.

Enzyme and pathway databases

BRENDAi 3.5.5.1. 2681.

Miscellaneous databases

GenomeRNAii 4817.
NextBioi 18562.
PROi Q86X76.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q86X76.
Bgeei Q86X76.
CleanExi HS_NIT1.
Genevestigatori Q86X76.

Family and domain databases

Gene3Di 3.60.110.10. 1 hit.
InterProi IPR003010. C-N_Hydrolase.
IPR001110. UPF0012_CS.
[Graphical view ]
Pfami PF00795. CN_hydrolase. 1 hit.
[Graphical view ]
SUPFAMi SSF56317. SSF56317. 1 hit.
PROSITEi PS50263. CN_HYDROLASE. 1 hit.
PS01227. UPF0012. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans."
    Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.
    Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Brain.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNIT1_HUMAN
AccessioniPrimary (citable) accession number: Q86X76
Secondary accession number(s): B1AQP3, D3DVF4, O76091
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: August 31, 2004
Last modified: September 3, 2014
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

According to Rosetta Stone theory, the existence of a fusion protein in one genome predicts that the separate polypeptides expressed in other organisms function in the same cellular or biochemical pathway. In Drosophila melanogaster and Caenorhabditis elegans, NitFhit is a fusion protein composed of a C-terminal Fhit domain and a domain related to plant and bacterial nitrilase.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi