Q86X76 (NIT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nitrilase homolog 1 EC=3.5.-.- | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 327 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2 By similarity. |
| Subcellular location | Cytoplasm. Mitochondrion By similarity. |
| Tissue specificity | Detected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. Ref.1 |
| Miscellaneous | According to Rosetta Stone theory, the existence of a fusion protein in one genome predicts that the separate polypeptides expressed in other organisms function in the same cellular or biochemical pathway. In Drosophila melanogaster and Caenorhabditis elegans, NitFhit is a fusion protein composed of a C-terminal Fhit domain and a domain related to plant and bacterial nitrilase. |
| Sequence similarities | Belongs to the UPF0012 family. Contains 1 CN hydrolase domain. |
| Sequence caution | The sequence AAH46149.1 differs from that shown. Reason: Chimeric cDNA. Its C-terminal exon is derived from the last exon of the DEDD gene. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nitrogen compound metabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | nitrilase activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q86X76-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform 1 (identifier: Q86X76-2) Also known as: 3; The sequence of this isoform differs from the canonical sequence as follows: 1-36: Missing. | ||||||
| Isoform 4 (identifier: Q86X76-3) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQ → MVLAISSCWA...PGRTYSLSRR 327-327: S → SDLTSVSLDLPLPPPPCHYELVLM | ||||||
| Isoform 5 (identifier: Q86X76-4) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPR → MTFGLRKRLSEERGFSLM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 327 | 327 | Nitrilase homolog 1 | PRO_0000213251 | |||||
Regions | |||||||||
| Domain | 47 – 320 | 274 | CN hydrolase | ||||||
Sites | |||||||||
| Active site | 86 | 1 | Proton acceptor Potential | ||||||
| Active site | 161 | 1 | By similarity | ||||||
| Active site | 203 | 1 | Nucleophile By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | Missing in isoform 1. | VSP_011546 | |||||
| Alternative sequence | 1 – 33 | 33 | MLGFI…CAQPR → MTFGLRKRLSEERGFSLM in isoform 5. | VSP_011545 | |||||
| Alternative sequence | 1 – 31 | 31 | MLGFI…VLCAQ → MVLAISSCWASSPGLLTDSC PFCVLDSGYLNSQYFVLSPG RTYSLSRR in isoform 4. | VSP_011544 | |||||
| Alternative sequence | 327 | 1 | S → SDLTSVSLDLPLPPPPCHYE LVLM in isoform 4. | VSP_011547 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans." Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M. Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY. |
| [2] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-239 (ISOFORM 2). Tissue: Brain. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF069984 Genomic DNA. Translation: AAC39901.1. AF069987 mRNA. Translation: AAC39907.1. CR541814 mRNA. Translation: CAG46613.1. CR541846 mRNA. Translation: CAG46644.1. AL591806 Genomic DNA. Translation: CAI15379.1. CH471121 Genomic DNA. Translation: EAW52656.1. CH471121 Genomic DNA. Translation: EAW52654.1. CH471121 Genomic DNA. Translation: EAW52657.1. BC046149 mRNA. Translation: AAH46149.1. Sequence problems. |
| IPI | IPI00023779. IPI00456663. IPI00456664. IPI00456665. |
| RefSeq | NP_001172021.1. NM_001185092.1. NP_001172022.1. NM_001185093.1. NP_001172023.1. NM_001185094.1. NP_005591.1. NM_005600.2. |
| UniGene | Hs.741277. |
3D structure databases | |
| ProteinModelPortal | Q86X76. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86X76. 1 interaction. |
| MINT | MINT-1194030. |
| STRING | 9606.ENSP00000356988. |
PTM databases | |
| PhosphoSite | Q86X76. |
Polymorphism databases | |
| DMDM | 51704324. |
Proteomic databases | |
| PaxDb | Q86X76. |
| PRIDE | Q86X76. |
Protocols and materials databases | |
| DNASU | 4817. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000368007; ENSP00000356986; ENSG00000158793. ENST00000368009; ENSP00000356988; ENSG00000158793. ENST00000392190; ENSP00000376028; ENSG00000158793. |
| GeneID | 4817. |
| KEGG | hsa:4817. |
| UCSC | uc001fxv.2. human. uc010pka.2. human. |
Organism-specific databases | |
| CTD | 4817. |
| GeneCards | GC01P161087. |
| HGNC | HGNC:7828. NIT1. |
| HPA | HPA006657. |
| MIM | 604618. gene. |
| neXtProt | NX_Q86X76. |
| PharmGKB | PA31636. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0388. |
| HOGENOM | HOG000222700. |
| HOVERGEN | HBG052628. |
| InParanoid | Q86X76. |
| KO | K01506. |
| OMA | STPDKEQ. |
| OrthoDB | EOG42RD7M. |
| PhylomeDB | Q86X76. |
Enzyme and pathway databases | |
| BRENDA | 3.5.5.1. 2681. |
Gene expression databases | |
| ArrayExpress | Q86X76. |
| Bgee | Q86X76. |
| CleanEx | HS_NIT1. |
| Genevestigator | Q86X76. |
| GermOnline | ENSG00000158793. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.60.110.10. 1 hit. |
| InterPro | IPR003010. C-N_Hydrolase. IPR001110. UPF0012_CS. [Graphical view] |
| Pfam | PF00795. CN_hydrolase. 1 hit. [Graphical view] |
| SUPFAM | SSF56317. Ntlse/CNhydtse. 1 hit. |
| PROSITE | PS50263. CN_HYDROLASE. 1 hit. PS01227. UPF0012. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 4817. |
| NextBio | 18562. |
| SOURCE | Search... |
Entry information
| Entry name | NIT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86X76 Secondary accession number(s): B1AQP3, D3DVF4, O76091 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
