Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nitrilase homolog 1

Gene

NIT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2 (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei86 – 861Proton acceptorPROSITE-ProRule annotation
Active sitei161 – 1611Proton donorPROSITE-ProRule annotation
Active sitei203 – 2031NucleophilePROSITE-ProRule annotation

GO - Molecular functioni

  1. nitrilase activity Source: ProtInc

GO - Biological processi

  1. nitrogen compound metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Names & Taxonomyi

Protein namesi
Recommended name:
Nitrilase homolog 1 (EC:3.5.-.-)
Gene namesi
Name:NIT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:7828. NIT1.

Subcellular locationi

Cytoplasm. Mitochondrion By similarity

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProtKB
  2. mitochondrion Source: UniProtKB-SubCell
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31636.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 327327Nitrilase homolog 1PRO_0000213251Add
BLAST

Proteomic databases

MaxQBiQ86X76.
PaxDbiQ86X76.
PRIDEiQ86X76.

PTM databases

PhosphoSiteiQ86X76.

Expressioni

Tissue specificityi

Detected in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

BgeeiQ86X76.
CleanExiHS_NIT1.
GenevestigatoriQ86X76.

Organism-specific databases

HPAiHPA006657.

Interactioni

Protein-protein interaction databases

BioGridi110882. 4 interactions.
IntActiQ86X76. 2 interactions.
MINTiMINT-1194030.
STRINGi9606.ENSP00000356988.

Structurei

3D structure databases

ProteinModelPortaliQ86X76.
SMRiQ86X76. Positions 48-319.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini47 – 320274CN hydrolasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 CN hydrolase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0388.
GeneTreeiENSGT00550000075099.
HOGENOMiHOG000222700.
HOVERGENiHBG052628.
InParanoidiQ86X76.
KOiK01506.
OMAiMCESNST.
OrthoDBiEOG7XDBGD.
PhylomeDBiQ86X76.
TreeFamiTF313080.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR003010. C-N_Hydrolase.
IPR001110. UPF0012_CS.
[Graphical view]
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
PS01227. UPF0012. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q86X76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGFITRPPH RFLSLLCPGL RIPQLSVLCA QPRPRAMAIS SSSCELPLVA
60 70 80 90 100
VCQVTSTPDK QQNFKTCAEL VREAARLGAC LAFLPEAFDF IARDPAETLH
110 120 130 140 150
LSEPLGGKLL EEYTQLAREC GLWLSLGGFH ERGQDWEQTQ KIYNCHVLLN
160 170 180 190 200
SKGAVVATYR KTHLCDVEIP GQGPMCESNS TMPGPSLESP VSTPAGKIGL
210 220 230 240 250
AVCYDMRFPE LSLALAQAGA EILTYPSAFG SITGPAHWEV LLRARAIETQ
260 270 280 290 300
CYVVAAAQCG RHHEKRASYG HSMVVDPWGT VVARCSEGPG LCLARIDLNY
310 320
LRQLRRHLPV FQHRRPDLYG NLGHPLS

Note: Major isoform.

Length:327
Mass (Da):35,896
Last modified:August 31, 2004 - v2
Checksum:i90F7FB9D4BA627B1
GO
Isoform 1 (identifier: Q86X76-2) [UniParc]FASTAAdd to basket

Also known as: 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:291
Mass (Da):31,859
Checksum:i314677E205F7ADDE
GO
Isoform 4 (identifier: Q86X76-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQ → MVLAISSCWA...PGRTYSLSRR
     327-327: S → SDLTSVSLDLPLPPPPCHYELVLM

Show »
Length:367
Mass (Da):40,200
Checksum:i178F0C4BBFE65D25
GO
Isoform 5 (identifier: Q86X76-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPR → MTFGLRKRLSEERGFSLM

Show »
Length:312
Mass (Da):34,323
Checksum:iA0BFFE4B76D24EE0
GO
Isoform 6 (identifier: Q86X76-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-243: VLLR → PVSS
     244-327: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a NIT1-DEDD fusion protein. The last 4 amino acids of this isoform (PVSS) are encoded by the last DEDD exon. No experimental confirmation available.

Show »
Length:243
Mass (Da):26,326
Checksum:i283B9E8D6A4EF67D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti79 – 791A → P in AAH46149 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636Missing in isoform 1. 1 PublicationVSP_011546Add
BLAST
Alternative sequencei1 – 3333MLGFI…CAQPR → MTFGLRKRLSEERGFSLM in isoform 5. 1 PublicationVSP_011545Add
BLAST
Alternative sequencei1 – 3131MLGFI…VLCAQ → MVLAISSCWASSPGLLTDSC PFCVLDSGYLNSQYFVLSPG RTYSLSRR in isoform 4. 1 PublicationVSP_011544Add
BLAST
Alternative sequencei240 – 2434VLLR → PVSS in isoform 6. 1 PublicationVSP_053711
Alternative sequencei244 – 32784Missing in isoform 6. 1 PublicationVSP_053712Add
BLAST
Alternative sequencei327 – 3271S → SDLTSVSLDLPLPPPPCHYE LVLM in isoform 4. 1 PublicationVSP_011547

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069984 Genomic DNA. Translation: AAC39901.1.
AF069987 mRNA. Translation: AAC39907.1.
CR541814 mRNA. Translation: CAG46613.1.
CR541846 mRNA. Translation: CAG46644.1.
AL591806 Genomic DNA. Translation: CAI15379.1.
CH471121 Genomic DNA. Translation: EAW52656.1.
CH471121 Genomic DNA. Translation: EAW52654.1.
CH471121 Genomic DNA. Translation: EAW52657.1.
BC046149 mRNA. Translation: AAH46149.1.
CCDSiCCDS1218.1. [Q86X76-1]
CCDS53401.1. [Q86X76-5]
CCDS53402.1. [Q86X76-4]
CCDS53403.1. [Q86X76-2]
RefSeqiNP_001172021.1. NM_001185092.1. [Q86X76-5]
NP_001172022.1. NM_001185093.1. [Q86X76-4]
NP_001172023.1. NM_001185094.1. [Q86X76-2]
NP_005591.1. NM_005600.2. [Q86X76-1]
XP_005245273.1. XM_005245216.2. [Q86X76-2]
UniGeneiHs.146406.

Genome annotation databases

EnsembliENST00000368007; ENSP00000356986; ENSG00000158793. [Q86X76-4]
ENST00000368008; ENSP00000356987; ENSG00000158793. [Q86X76-5]
ENST00000368009; ENSP00000356988; ENSG00000158793. [Q86X76-1]
ENST00000392190; ENSP00000376028; ENSG00000158793. [Q86X76-2]
GeneIDi4817.
KEGGihsa:4817.
UCSCiuc001fxv.2. human. [Q86X76-1]
uc010pka.2. human. [Q86X76-4]

Polymorphism databases

DMDMi51704324.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069984 Genomic DNA. Translation: AAC39901.1.
AF069987 mRNA. Translation: AAC39907.1.
CR541814 mRNA. Translation: CAG46613.1.
CR541846 mRNA. Translation: CAG46644.1.
AL591806 Genomic DNA. Translation: CAI15379.1.
CH471121 Genomic DNA. Translation: EAW52656.1.
CH471121 Genomic DNA. Translation: EAW52654.1.
CH471121 Genomic DNA. Translation: EAW52657.1.
BC046149 mRNA. Translation: AAH46149.1.
CCDSiCCDS1218.1. [Q86X76-1]
CCDS53401.1. [Q86X76-5]
CCDS53402.1. [Q86X76-4]
CCDS53403.1. [Q86X76-2]
RefSeqiNP_001172021.1. NM_001185092.1. [Q86X76-5]
NP_001172022.1. NM_001185093.1. [Q86X76-4]
NP_001172023.1. NM_001185094.1. [Q86X76-2]
NP_005591.1. NM_005600.2. [Q86X76-1]
XP_005245273.1. XM_005245216.2. [Q86X76-2]
UniGeneiHs.146406.

3D structure databases

ProteinModelPortaliQ86X76.
SMRiQ86X76. Positions 48-319.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110882. 4 interactions.
IntActiQ86X76. 2 interactions.
MINTiMINT-1194030.
STRINGi9606.ENSP00000356988.

PTM databases

PhosphoSiteiQ86X76.

Polymorphism databases

DMDMi51704324.

Proteomic databases

MaxQBiQ86X76.
PaxDbiQ86X76.
PRIDEiQ86X76.

Protocols and materials databases

DNASUi4817.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368007; ENSP00000356986; ENSG00000158793. [Q86X76-4]
ENST00000368008; ENSP00000356987; ENSG00000158793. [Q86X76-5]
ENST00000368009; ENSP00000356988; ENSG00000158793. [Q86X76-1]
ENST00000392190; ENSP00000376028; ENSG00000158793. [Q86X76-2]
GeneIDi4817.
KEGGihsa:4817.
UCSCiuc001fxv.2. human. [Q86X76-1]
uc010pka.2. human. [Q86X76-4]

Organism-specific databases

CTDi4817.
GeneCardsiGC01P161087.
HGNCiHGNC:7828. NIT1.
HPAiHPA006657.
MIMi604618. gene.
neXtProtiNX_Q86X76.
PharmGKBiPA31636.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0388.
GeneTreeiENSGT00550000075099.
HOGENOMiHOG000222700.
HOVERGENiHBG052628.
InParanoidiQ86X76.
KOiK01506.
OMAiMCESNST.
OrthoDBiEOG7XDBGD.
PhylomeDBiQ86X76.
TreeFamiTF313080.

Miscellaneous databases

ChiTaRSiNIT1. human.
GenomeRNAii4817.
NextBioi18562.
PROiQ86X76.
SOURCEiSearch...

Gene expression databases

BgeeiQ86X76.
CleanExiHS_NIT1.
GenevestigatoriQ86X76.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR003010. C-N_Hydrolase.
IPR001110. UPF0012_CS.
[Graphical view]
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
PS01227. UPF0012. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans."
    Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.
    Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 4 AND 5), TISSUE SPECIFICITY.
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S., Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W., Korn B., Zuo D., Hu Y., LaBaer J.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Brain.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNIT1_HUMAN
AccessioniPrimary (citable) accession number: Q86X76
Secondary accession number(s): B1AQP3, D3DVF4, O76091
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: August 31, 2004
Last modified: April 1, 2015
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

According to Rosetta Stone theory, the existence of a fusion protein in one genome predicts that the separate polypeptides expressed in other organisms function in the same cellular or biochemical pathway. In Drosophila melanogaster and Caenorhabditis elegans, NitFhit is a fusion protein composed of a C-terminal Fhit domain and a domain related to plant and bacterial nitrilase.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.