Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipolysis-stimulated lipoprotein receptor

Gene

LSR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity).By similarity

Caution

In contrast to the rodent orthologous protein, it is longer in N-terminus and no signal sequence is detected by any prediction method.Curated

GO - Biological processi

Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

ReactomeiR-HSA-8964038 LDL clearance
R-HSA-8964046 VLDL clearance

Names & Taxonomyi

Protein namesi
Recommended name:
Lipolysis-stimulated lipoprotein receptor
Gene namesi
Name:LSR
Synonyms:LISCH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000105699.16
HGNCiHGNC:29572 LSR
MIMi616582 gene
neXtProtiNX_Q86X29

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 259ExtracellularSequence analysisAdd BLAST259
Transmembranei260 – 280HelicalSequence analysisAdd BLAST21
Topological domaini281 – 649CytoplasmicSequence analysisAdd BLAST369

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

Pathology & Biotechi

Organism-specific databases

DisGeNETi51599
OpenTargetsiENSG00000105699
PharmGKBiPA142671504

Polymorphism and mutation databases

BioMutaiLSR
DMDMi116242622

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002453081 – 649Lipolysis-stimulated lipoprotein receptorAdd BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi111 ↔ 218PROSITE-ProRule annotation
Modified residuei336PhosphothreonineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Modified residuei389PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei453PhosphothreonineCombined sources1
Modified residuei464PhosphoserineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei493PhosphoserineCombined sources1
Modified residuei501PhosphothreonineCombined sources1
Modified residuei528PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei535PhosphotyrosineCombined sources1
Modified residuei540PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei631PhosphoserineCombined sources1
Modified residuei643PhosphoserineCombined sources1
Modified residuei646PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

EPDiQ86X29
MaxQBiQ86X29
PaxDbiQ86X29
PeptideAtlasiQ86X29
PRIDEiQ86X29

PTM databases

iPTMnetiQ86X29
PhosphoSitePlusiQ86X29
SwissPalmiQ86X29

Expressioni

Gene expression databases

BgeeiENSG00000105699
CleanExiHS_LSR
ExpressionAtlasiQ86X29 baseline and differential
GenevisibleiQ86X29 HS

Organism-specific databases

HPAiHPA007270

Interactioni

Subunit structurei

Homotrimer or homotetramer.By similarity

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi11962962 interactors.
IntActiQ86X29 11 interactors.
MINTiQ86X29
STRINGi9606.ENSP00000354575

Structurei

3D structure databases

ProteinModelPortaliQ86X29
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini86 – 234Ig-like V-typeAdd BLAST149

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi280 – 304Cys-richAdd BLAST25

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKMJ Eukaryota
ENOG411004A LUCA
GeneTreeiENSGT00430000030906
HOGENOMiHOG000253962
HOVERGENiHBG061576
InParanoidiQ86X29
OMAiDWRSRPS
OrthoDBiEOG091G0875
PhylomeDBiQ86X29
TreeFamiTF330877

Family and domain databases

InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR003599 Ig_sub
IPR008664 LISCH7
PfamiView protein in Pfam
PF05624 LSR, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86X29-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQQDGLGVGT RNGSGKGRSV HPSWPWCAPR PLRYFGRDAR ARRAQTAAMA
60 70 80 90 100
LLAGGLSRGL GSHPAAAGRD AVVFVWLLLS TWCTAPARAI QVTVSNPYHV
110 120 130 140 150
VILFQPVTLP CTYQMTSTPT QPIVIWKYKS FCRDRIADAF SPASVDNQLN
160 170 180 190 200
AQLAAGNPGY NPYVECQDSV RTVRVVATKQ GNAVTLGDYY QGRRITITGN
210 220 230 240 250
ADLTFDQTAW GDSGVYYCSV VSAQDLQGNN EAYAELIVLG RTSGVAELLP
260 270 280 290 300
GFQAGPIEDW LFVVVVCLAA FLIFLLLGIC WCQCCPHTCC CYVRCPCCPD
310 320 330 340 350
KCCCPEALYA AGKAATSGVP SIYAPSTYAH LSPAKTPPPP AMIPMGPAYN
360 370 380 390 400
GYPGGYPGDV DRSSSAGGQG SYVPLLRDTD SSVASEVRSG YRIQASQQDD
410 420 430 440 450
SMRVLYYMEK ELANFDPSRP GPPSGRVERA MSEVTSLHED DWRSRPSRGP
460 470 480 490 500
ALTPIRDEEW GGHSPRSPRG WDQEPAREQA GGGWRARRPR ARSVDALDDL
510 520 530 540 550
TPPSTAESGS RSPTSNGGRS RAYMPPRSRS RDDLYDQDDS RDFPRSRDPH
560 570 580 590 600
YDDFRSRERP PADPRSHHHR TRDPRDNGSR SGDLPYDGRL LEEAVRKKGS
610 620 630 640
EERRRPHKEE EEEAYYPPAP PPYSETDSQA SRERRLKKNL ALSRESLVV
Length:649
Mass (Da):71,439
Last modified:October 17, 2006 - v4
Checksum:i01E8F1CE0197CE9B
GO
Isoform 2 (identifier: Q86X29-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-88: Missing.
     366-386: Missing.

Show »
Length:591
Mass (Da):65,587
Checksum:iE254FA92B362D418
GO
Isoform 3 (identifier: Q86X29-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.
     386-386: Missing.

Show »
Length:629
Mass (Da):69,429
Checksum:i32D531E33D09464E
GO
Isoform 4 (identifier: Q86X29-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.

Show »
Length:630
Mass (Da):69,558
Checksum:i2569488B01545053
GO
Isoform 5 (identifier: Q86X29-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-308: GRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL → V

Note: No experimental confirmation available.
Show »
Length:581
Mass (Da):64,053
Checksum:iED8EC7A3B3BDB8D3
GO
Isoform 6 (identifier: Q86X29-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.
     200-308: NADLTFDQTA...PDKCCCPEAL → M

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):54,498
Checksum:i8C0EDAF2784F9FCF
GO

Sequence cautioni

The sequence AAB51178 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAB58317 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAH04381 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti259D → G in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti308L → R in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti430A → G in AAB51178 (PubMed:15057824).Curated1
Sequence conflicti518G → GR in BAC86714 (PubMed:14702039).Curated1
Sequence conflicti518G → GR in BAC11614 (PubMed:16303743).Curated1
Sequence conflicti518G → GR in AAH04381 (PubMed:15489334).Curated1
Sequence conflicti639N → D in AAB51178 (PubMed:15057824).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049902363S → N2 PublicationsCorresponds to variant dbSNP:rs34259399Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0572101 – 48Missing in isoform 6. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_01969152 – 88Missing in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_057211200 – 308NADLT…CPEAL → M in isoform 6. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_046797240 – 308GRTSG…CPEAL → V in isoform 5. CuratedAdd BLAST69
Alternative sequenceiVSP_019692240 – 258Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST19
Alternative sequenceiVSP_019693366 – 386Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_019694386Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF130366 mRNA Translation: AAD22101.1
AK075426 mRNA Translation: BAC11614.1
AK126834 mRNA Translation: BAC86714.1
AK296618 mRNA Translation: BAG59226.1
AC002128 Genomic DNA Translation: AAB58317.1 Sequence problems.
AD000684 Genomic DNA Translation: AAB51178.1 Sequence problems.
BC004381 mRNA Translation: AAH04381.2 Different initiation.
BC047376 mRNA Translation: AAH47376.2
CCDSiCCDS12449.1 [Q86X29-4]
CCDS12450.1 [Q86X29-1]
CCDS12451.1 [Q86X29-5]
CCDS59376.1 [Q86X29-3]
RefSeqiNP_001247418.1, NM_001260489.1 [Q86X29-3]
NP_001247419.1, NM_001260490.1
NP_057009.3, NM_015925.6 [Q86X29-4]
NP_991403.1, NM_205834.3 [Q86X29-1]
NP_991404.1, NM_205835.3 [Q86X29-5]
UniGeneiHs.466507

Genome annotation databases

EnsembliENST00000347609; ENSP00000262627; ENSG00000105699 [Q86X29-2]
ENST00000354900; ENSP00000346976; ENSG00000105699 [Q86X29-4]
ENST00000360798; ENSP00000354034; ENSG00000105699 [Q86X29-5]
ENST00000361790; ENSP00000354575; ENSG00000105699 [Q86X29-1]
ENST00000427250; ENSP00000394479; ENSG00000105699 [Q86X29-6]
ENST00000602122; ENSP00000472569; ENSG00000105699 [Q86X29-3]
ENST00000621372; ENSP00000480821; ENSG00000105699 [Q86X29-1]
GeneIDi51599
KEGGihsa:51599
UCSCiuc002nyl.4 human [Q86X29-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLSR_HUMAN
AccessioniPrimary (citable) accession number: Q86X29
Secondary accession number(s): A6NDW3
, B4DKL4, E9PHD4, O00112, O00426, Q6ZT80, Q8NBM0, Q9BT33, Q9UQL3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 17, 2006
Last modified: March 28, 2018
This is version 151 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome