Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipolysis-stimulated lipoprotein receptor

Gene

LSR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable role in the clearance of triglyceride-rich lipoprotein from blood. Binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cells (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Lipolysis-stimulated lipoprotein receptor
Gene namesi
Name:LSR
Synonyms:LISCH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:29572. LSR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 259259ExtracellularSequence analysisAdd
BLAST
Transmembranei260 – 28021HelicalSequence analysisAdd
BLAST
Topological domaini281 – 649369CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Chylomicron, LDL, Membrane, VLDL

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671504.

Polymorphism and mutation databases

BioMutaiLSR.
DMDMi116242622.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 649649Lipolysis-stimulated lipoprotein receptorPRO_0000245308Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi111 ↔ 218PROSITE-ProRule annotation
Modified residuei336 – 3361PhosphothreonineBy similarity
Modified residuei365 – 3651PhosphoserineCombined sources
Modified residuei371 – 3711PhosphoserineCombined sources
Modified residuei389 – 3891PhosphoserineCombined sources
Modified residuei432 – 4321PhosphoserineCombined sources
Modified residuei436 – 4361PhosphoserineCombined sources
Modified residuei453 – 4531PhosphothreonineCombined sources
Modified residuei464 – 4641PhosphoserineCombined sources
Modified residuei467 – 4671PhosphoserineCombined sources
Modified residuei493 – 4931PhosphoserineCombined sources
Modified residuei501 – 5011PhosphothreonineCombined sources
Modified residuei528 – 5281PhosphoserineCombined sources
Modified residuei530 – 5301PhosphoserineCombined sources
Modified residuei535 – 5351PhosphotyrosineCombined sources
Modified residuei540 – 5401PhosphoserineCombined sources
Modified residuei579 – 5791PhosphoserineCombined sources
Modified residuei631 – 6311PhosphoserineCombined sources
Modified residuei643 – 6431PhosphoserineCombined sources
Modified residuei646 – 6461PhosphoserineCombined sources

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

EPDiQ86X29.
MaxQBiQ86X29.
PaxDbiQ86X29.
PeptideAtlasiQ86X29.
PRIDEiQ86X29.

PTM databases

iPTMnetiQ86X29.
PhosphoSiteiQ86X29.
SwissPalmiQ86X29.

Expressioni

Gene expression databases

BgeeiENSG00000105699.
CleanExiHS_LSR.
ExpressionAtlasiQ86X29. baseline and differential.
GenevisibleiQ86X29. HS.

Organism-specific databases

HPAiHPA007270.

Interactioni

Subunit structurei

Homotrimer or homotetramer.By similarity

Protein-protein interaction databases

BioGridi119629. 44 interactions.
IntActiQ86X29. 9 interactions.
MINTiMINT-5000691.
STRINGi9606.ENSP00000354575.

Structurei

3D structure databases

ProteinModelPortaliQ86X29.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 234149Ig-like V-typeAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi280 – 30425Cys-richAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ86X29.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ86X29.
TreeFamiTF330877.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86X29-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQQDGLGVGT RNGSGKGRSV HPSWPWCAPR PLRYFGRDAR ARRAQTAAMA
60 70 80 90 100
LLAGGLSRGL GSHPAAAGRD AVVFVWLLLS TWCTAPARAI QVTVSNPYHV
110 120 130 140 150
VILFQPVTLP CTYQMTSTPT QPIVIWKYKS FCRDRIADAF SPASVDNQLN
160 170 180 190 200
AQLAAGNPGY NPYVECQDSV RTVRVVATKQ GNAVTLGDYY QGRRITITGN
210 220 230 240 250
ADLTFDQTAW GDSGVYYCSV VSAQDLQGNN EAYAELIVLG RTSGVAELLP
260 270 280 290 300
GFQAGPIEDW LFVVVVCLAA FLIFLLLGIC WCQCCPHTCC CYVRCPCCPD
310 320 330 340 350
KCCCPEALYA AGKAATSGVP SIYAPSTYAH LSPAKTPPPP AMIPMGPAYN
360 370 380 390 400
GYPGGYPGDV DRSSSAGGQG SYVPLLRDTD SSVASEVRSG YRIQASQQDD
410 420 430 440 450
SMRVLYYMEK ELANFDPSRP GPPSGRVERA MSEVTSLHED DWRSRPSRGP
460 470 480 490 500
ALTPIRDEEW GGHSPRSPRG WDQEPAREQA GGGWRARRPR ARSVDALDDL
510 520 530 540 550
TPPSTAESGS RSPTSNGGRS RAYMPPRSRS RDDLYDQDDS RDFPRSRDPH
560 570 580 590 600
YDDFRSRERP PADPRSHHHR TRDPRDNGSR SGDLPYDGRL LEEAVRKKGS
610 620 630 640
EERRRPHKEE EEEAYYPPAP PPYSETDSQA SRERRLKKNL ALSRESLVV
Length:649
Mass (Da):71,439
Last modified:October 17, 2006 - v4
Checksum:i01E8F1CE0197CE9B
GO
Isoform 2 (identifier: Q86X29-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-88: Missing.
     366-386: Missing.

Show »
Length:591
Mass (Da):65,587
Checksum:iE254FA92B362D418
GO
Isoform 3 (identifier: Q86X29-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.
     386-386: Missing.

Show »
Length:629
Mass (Da):69,429
Checksum:i32D531E33D09464E
GO
Isoform 4 (identifier: Q86X29-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-258: Missing.

Show »
Length:630
Mass (Da):69,558
Checksum:i2569488B01545053
GO
Isoform 5 (identifier: Q86X29-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-308: GRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL → V

Note: No experimental confirmation available.
Show »
Length:581
Mass (Da):64,053
Checksum:iED8EC7A3B3BDB8D3
GO
Isoform 6 (identifier: Q86X29-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.
     200-308: NADLTFDQTA...PDKCCCPEAL → M

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):54,498
Checksum:i8C0EDAF2784F9FCF
GO

Sequence cautioni

The sequence AAB51178 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence AAB58317 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence AAH04381 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti259 – 2591D → G in AAB51178 (PubMed:15057824).Curated
Sequence conflicti308 – 3081L → R in AAB51178 (PubMed:15057824).Curated
Sequence conflicti430 – 4301A → G in AAB51178 (PubMed:15057824).Curated
Sequence conflicti518 – 5181G → GR in BAC86714 (PubMed:14702039).Curated
Sequence conflicti518 – 5181G → GR in BAC11614 (PubMed:16303743).Curated
Sequence conflicti518 – 5181G → GR in AAH04381 (PubMed:15489334).Curated
Sequence conflicti639 – 6391N → D in AAB51178 (PubMed:15057824).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti363 – 3631S → N.2 Publications
Corresponds to variant rs34259399 [ dbSNP | Ensembl ].
VAR_049902

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4848Missing in isoform 6. 1 PublicationVSP_057210Add
BLAST
Alternative sequencei52 – 8837Missing in isoform 2. 1 PublicationVSP_019691Add
BLAST
Alternative sequencei200 – 308109NADLT…CPEAL → M in isoform 6. 1 PublicationVSP_057211Add
BLAST
Alternative sequencei240 – 30869GRTSG…CPEAL → V in isoform 5. CuratedVSP_046797Add
BLAST
Alternative sequencei240 – 25819Missing in isoform 3 and isoform 4. 3 PublicationsVSP_019692Add
BLAST
Alternative sequencei366 – 38621Missing in isoform 2. 1 PublicationVSP_019693Add
BLAST
Alternative sequencei386 – 3861Missing in isoform 3. 1 PublicationVSP_019694

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF130366 mRNA. Translation: AAD22101.1.
AK075426 mRNA. Translation: BAC11614.1.
AK126834 mRNA. Translation: BAC86714.1.
AK296618 mRNA. Translation: BAG59226.1.
AC002128 Genomic DNA. Translation: AAB58317.1. Sequence problems.
AD000684 Genomic DNA. Translation: AAB51178.1. Sequence problems.
BC004381 mRNA. Translation: AAH04381.2. Different initiation.
BC047376 mRNA. Translation: AAH47376.2.
CCDSiCCDS12449.1. [Q86X29-4]
CCDS12450.1. [Q86X29-1]
CCDS12451.1. [Q86X29-5]
CCDS59376.1. [Q86X29-3]
RefSeqiNP_001247418.1. NM_001260489.1. [Q86X29-3]
NP_001247419.1. NM_001260490.1.
NP_057009.3. NM_015925.6. [Q86X29-4]
NP_991403.1. NM_205834.3. [Q86X29-1]
NP_991404.1. NM_205835.3. [Q86X29-5]
UniGeneiHs.466507.

Genome annotation databases

EnsembliENST00000347609; ENSP00000262627; ENSG00000105699. [Q86X29-2]
ENST00000354900; ENSP00000346976; ENSG00000105699. [Q86X29-4]
ENST00000360798; ENSP00000354034; ENSG00000105699. [Q86X29-5]
ENST00000361790; ENSP00000354575; ENSG00000105699. [Q86X29-1]
ENST00000427250; ENSP00000394479; ENSG00000105699. [Q86X29-6]
ENST00000602122; ENSP00000472569; ENSG00000105699. [Q86X29-3]
ENST00000621372; ENSP00000480821; ENSG00000105699. [Q86X29-1]
GeneIDi51599.
KEGGihsa:51599.
UCSCiuc002nyl.4. human. [Q86X29-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF130366 mRNA. Translation: AAD22101.1.
AK075426 mRNA. Translation: BAC11614.1.
AK126834 mRNA. Translation: BAC86714.1.
AK296618 mRNA. Translation: BAG59226.1.
AC002128 Genomic DNA. Translation: AAB58317.1. Sequence problems.
AD000684 Genomic DNA. Translation: AAB51178.1. Sequence problems.
BC004381 mRNA. Translation: AAH04381.2. Different initiation.
BC047376 mRNA. Translation: AAH47376.2.
CCDSiCCDS12449.1. [Q86X29-4]
CCDS12450.1. [Q86X29-1]
CCDS12451.1. [Q86X29-5]
CCDS59376.1. [Q86X29-3]
RefSeqiNP_001247418.1. NM_001260489.1. [Q86X29-3]
NP_001247419.1. NM_001260490.1.
NP_057009.3. NM_015925.6. [Q86X29-4]
NP_991403.1. NM_205834.3. [Q86X29-1]
NP_991404.1. NM_205835.3. [Q86X29-5]
UniGeneiHs.466507.

3D structure databases

ProteinModelPortaliQ86X29.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119629. 44 interactions.
IntActiQ86X29. 9 interactions.
MINTiMINT-5000691.
STRINGi9606.ENSP00000354575.

PTM databases

iPTMnetiQ86X29.
PhosphoSiteiQ86X29.
SwissPalmiQ86X29.

Polymorphism and mutation databases

BioMutaiLSR.
DMDMi116242622.

Proteomic databases

EPDiQ86X29.
MaxQBiQ86X29.
PaxDbiQ86X29.
PeptideAtlasiQ86X29.
PRIDEiQ86X29.

Protocols and materials databases

DNASUi51599.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000347609; ENSP00000262627; ENSG00000105699. [Q86X29-2]
ENST00000354900; ENSP00000346976; ENSG00000105699. [Q86X29-4]
ENST00000360798; ENSP00000354034; ENSG00000105699. [Q86X29-5]
ENST00000361790; ENSP00000354575; ENSG00000105699. [Q86X29-1]
ENST00000427250; ENSP00000394479; ENSG00000105699. [Q86X29-6]
ENST00000602122; ENSP00000472569; ENSG00000105699. [Q86X29-3]
ENST00000621372; ENSP00000480821; ENSG00000105699. [Q86X29-1]
GeneIDi51599.
KEGGihsa:51599.
UCSCiuc002nyl.4. human. [Q86X29-1]

Organism-specific databases

CTDi51599.
GeneCardsiLSR.
HGNCiHGNC:29572. LSR.
HPAiHPA007270.
MIMi616582. gene.
neXtProtiNX_Q86X29.
PharmGKBiPA142671504.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKMJ. Eukaryota.
ENOG411004A. LUCA.
GeneTreeiENSGT00430000030906.
HOGENOMiHOG000253962.
HOVERGENiHBG061576.
InParanoidiQ86X29.
OMAiPPAMIPM.
OrthoDBiEOG091G0875.
PhylomeDBiQ86X29.
TreeFamiTF330877.

Miscellaneous databases

ChiTaRSiLSR. human.
GeneWikiiLSR_(gene).
GenomeRNAii51599.
PROiQ86X29.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105699.
CleanExiHS_LSR.
ExpressionAtlasiQ86X29. baseline and differential.
GenevisibleiQ86X29. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR008664. LISCH7.
[Graphical view]
PfamiPF05624. LSR. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLSR_HUMAN
AccessioniPrimary (citable) accession number: Q86X29
Secondary accession number(s): A6NDW3
, B4DKL4, E9PHD4, O00112, O00426, Q6ZT80, Q8NBM0, Q9BT33, Q9UQL3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 17, 2006
Last modified: September 7, 2016
This is version 139 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

In contrast to the rodent orthologous protein, it is longer in N-terminus and no signal sequence is detected by any prediction method.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.