Q86WA6 (BPHL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Valacyclovir hydrolase Short name=VACVase Short name=Valacyclovirase EC=3.1.-.- Alternative name(s): Biphenyl hydrolase-like protein Biphenyl hydrolase-related protein Short name=Bph-rp Breast epithelial mucin-associated antigen Short name=MCNAA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 291 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. Ref.13 |
| Subunit structure | |
| Tissue specificity | Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle. Ref.1 |
| Sequence similarities | Belongs to the AB hydrolase superfamily. Lipase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Hydrolase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular amino acid metabolic process Traceable author statement Ref.1. Source: ProtInc response to toxic substanceTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | mitochondrion Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular_function | hydrolase activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86WA6-1) Also known as: Beta; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86WA6-2) Also known as: Alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-36: MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFG → MPRNLLYSLLSSHLSPHFS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 37 | 37 | Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 38 – 291 | 254 | Valacyclovir hydrolase | PRO_0000017841 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 139 | 1 | Nucleophile Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 244 | 1 | Charge relay system Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 272 | 1 | Charge relay system Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 140 | 1 | Binding of alpha-amino group of substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 126 | 1 | N6-acetyllysine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 36 | 36 | MVAVL…AAAFG → MPRNLLYSLLSSHLSPHFS in isoform 2. | VSP_009115 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 139 | 1 | S → A: <0.1% of wild type activity. Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 244 | 1 | D → N: <0.1% of wild type activity. Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 272 | 1 | H → A: Complete loss of activity. Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 182 | 1 | V → R in CAA40859. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 261 | 1 | G → A in CAA40859. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 40 – 46 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 57 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 66 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 76 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 78 – 83 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 86 – 88 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 94 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 127 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 131 – 138 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 140 – 151 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 153 – 155 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 156 – 163 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 177 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 187 – 197 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 199 – 214 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 215 – 218 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 222 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 223 – 225 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 226 – 231 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 241 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 247 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 249 – 258 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 263 – 267 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 274 – 277 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 279 – 290 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression analysis of a novel human serine hydrolase with sequence similarity to prokaryotic enzymes involved in the degradation of aromatic compounds." Puente X.S., Lopez-Otin C. J. Biol. Chem. 270:12926-12932(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PROTEIN SEQUENCE OF 152-158; 181-184 AND 209-214, TISSUE SPECIFICITY. Tissue: Mammary carcinoma. |
| [2] | Puente X.S. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORMS 1 AND 2). Tissue: Mammary carcinoma. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Cloning and sequencing of a complementary DNA encoding a M(r) 70,000 human breast epithelial mucin-associated antigen." Larocca D., Peterson J.A., Walkup G., Urrea R., Ceriani R.L. Cancer Res. 50:5925-5930(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 182-280. |
| [7] | "Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase." Kim I., Chu X.-Y., Kim S., Provoda C.J., Lee K.-D., Amidon G.L. J. Biol. Chem. 278:25348-25356(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 38-56, CHARACTERIZATION. |
| [8] | "Structural characterization and chromosomal localization of the gene encoding human biphenyl hydrolase-related protein (BPHL)." Puente X.S., Pendas A.M., Lopez-Otin C. Genomics 51:459-462(1998) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL LOCATION. |
| [9] | Kim I. Submitted (DEC-2003) to UniProtKB Cited for: SUBUNIT. |
| [10] | "A novel nucleoside prodrug-activating enzyme: substrate specificity of biphenyl hydrolase-like protein." Kim I., Song X., Vig B.S., Mittal S., Shin H.-C., Lorenzi P.J., Amidon G.L. Mol. Pharm. 1:117-127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBSTRATE SPECIFICITY. |
| [11] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-126, MASS SPECTROMETRY. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase." Lai L., Xu Z., Zhou J., Lee K.D., Amidon G.L. J. Biol. Chem. 283:9318-9327(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.75 ANGSTROMS) OF 38-291, FUNCTION, SUBUNIT, ACTIVE SITES, MUTAGENESIS OF SER-139; ASP-244 AND HIS-272. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X81372 mRNA. Translation: CAA57137.1. AJ617684 mRNA. Translation: CAE85120.1. AL031963 Genomic DNA. Translation: CAD70626.1. AL031963 Genomic DNA. Translation: CAD70627.1. CH471087 Genomic DNA. Translation: EAW55122.1. BC106901 mRNA. Translation: AAI06902.1. X57653 mRNA. Translation: CAA40859.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00003990. IPI00384428. | ||||||||||||||||||||||||||||||
| PIR | A56716. | ||||||||||||||||||||||||||||||
| RefSeq | NP_004323.2. NM_004332.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.10136. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q86WA6. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||
| MEROPS | S33.982. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q86WA6. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 39931107. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q86WA6. | ||||||||||||||||||||||||||||||
| PRIDE | Q86WA6. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000380375; ENSP00000369734; ENSG00000137274. ENST00000380379; ENSP00000369739; ENSG00000137274. ENST00000434640; ENSP00000390472; ENSG00000137274. | ||||||||||||||||||||||||||||||
| GeneID | 670. | ||||||||||||||||||||||||||||||
| KEGG | hsa:670. | ||||||||||||||||||||||||||||||
| UCSC | uc003muy.3. human. uc003mva.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 670. | ||||||||||||||||||||||||||||||
| GeneCards | GC06P003118. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0020996. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:1094. BPHL. | ||||||||||||||||||||||||||||||
| HPA | HPA036752. | ||||||||||||||||||||||||||||||
| MIM | 603156. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q86WA6. | ||||||||||||||||||||||||||||||
| PharmGKB | PA25402. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG0596. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000044258. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG048762. | ||||||||||||||||||||||||||||||
| InParanoid | Q86WA6. | ||||||||||||||||||||||||||||||
| KO | K01175. | ||||||||||||||||||||||||||||||
| OMA | NAYVTEE. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q86WA6. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| SABIO-RK | Q86WA6. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q86WA6. | ||||||||||||||||||||||||||||||
| Bgee | Q86WA6. | ||||||||||||||||||||||||||||||
| CleanEx | HS_BPHL. | ||||||||||||||||||||||||||||||
| Genevestigator | Q86WA6. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000137274. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| PROSITE | PS00120. LIPASE_SER. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | BPHL. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q86WA6. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 670. | ||||||||||||||||||||||||||||||
| NextBio | 2744. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | BPHL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86WA6 Secondary accession number(s): Q00306, Q13855, Q3KP51 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
