Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein adipocyte-associated 1

Gene

TPRA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  • G-protein coupled receptor activity Source: ProtInc

GO - Biological processi

  • aging Source: ProtInc
  • embryonic cleavage Source: Ensembl
  • lipid metabolic process Source: ProtInc
  • negative regulation of mitotic cell cycle phase transition Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein adipocyte-associated 1
Alternative name(s):
Integral membrane protein GPR175
Transmembrane protein 227
Gene namesi
Name:TPRA1
Synonyms:GPR175, TMEM227
ORF Names:PP6566
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:30413. TPRA1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei48 – 6821Helical; Name=1Sequence analysisAdd
BLAST
Transmembranei76 – 9621Helical; Name=2Sequence analysisAdd
BLAST
Transmembranei123 – 14321Helical; Name=3Sequence analysisAdd
BLAST
Transmembranei151 – 17121Helical; Name=4Sequence analysisAdd
BLAST
Transmembranei192 – 21221Helical; Name=5Sequence analysisAdd
BLAST
Transmembranei234 – 25421Helical; Name=6Sequence analysisAdd
BLAST
Transmembranei265 – 28521Helical; Name=7Sequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165698543.

Polymorphism and mutation databases

DMDMi74727643.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 373373Transmembrane protein adipocyte-associated 1PRO_0000076099Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi11 – 111N-linked (GlcNAc...)Sequence analysis
Glycosylationi23 – 231N-linked (GlcNAc...)Sequence analysis
Glycosylationi361 – 3611N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ86W33.
PaxDbiQ86W33.
PeptideAtlasiQ86W33.
PRIDEiQ86W33.

PTM databases

iPTMnetiQ86W33.
PhosphoSiteiQ86W33.

Expressioni

Tissue specificityi

Ubiquitous, with higher levels in heart, placenta and kidney.1 Publication

Gene expression databases

BgeeiENSG00000163870.
CleanExiHS_GPR175.
ExpressionAtlasiQ86W33. baseline and differential.
GenevisibleiQ86W33. HS.

Organism-specific databases

HPAiHPA019784.

Interactioni

Protein-protein interaction databases

BioGridi126289. 25 interactions.
STRINGi9606.ENSP00000347748.

Structurei

3D structure databases

ProteinModelPortaliQ86W33.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the UPF0359 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4536. Eukaryota.
ENOG410XRXY. LUCA.
GeneTreeiENSGT00390000016807.
HOGENOMiHOG000112778.
HOVERGENiHBG081569.
InParanoidiQ86W33.
OMAiMFLLWKL.
OrthoDBiEOG091G074F.
PhylomeDBiQ86W33.
TreeFamiTF314072.

Family and domain databases

InterProiIPR018781. TPRA40.
[Graphical view]
PANTHERiPTHR15876. PTHR15876. 1 hit.
PfamiPF10160. Tmemb_40. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86W33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTLEEVTWA NGSTALPPPL APNISVPHRC LLLLYEDIGT SRVRYWDLLL
60 70 80 90 100
LIPNVLFLIF LLWKLPSARA KIRITSSPIF ITFYILVFVV ALVGIARAVV
110 120 130 140 150
SMTVSTSNAA TVADKILWEI TRFFLLAIEL SVIILGLAFG HLESKSSIKR
160 170 180 190 200
VLAITTVLSL AYSVTQGTLE ILYPDAHLSA EDFNIYGHGG RQFWLVSSCF
210 220 230 240 250
FFLVYSLVVI LPKTPLKERI SLPSRRSFYV YAGILALLNL LQGLGSVLLC
260 270 280 290 300
FDIIEGLCCV DATTFLYFSF FAPLIYVAFL RGFFGSEPKI LFSYKCQVDE
310 320 330 340 350
TEEPDVHLPQ PYAVARREGL EAAGAAGASA ASYSSTQFDS AGGVAYLDDI
360 370
ASMPCHTGSI NSTDSERWKA INA
Length:373
Mass (Da):41,053
Last modified:June 1, 2003 - v1
Checksum:iDDD489CBB98EAF1A
GO
Isoform 2 (identifier: Q86W33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-239: VYSLVVILPKTPLKERISLPSRRSFYVYAGILALLN → LGGASTCMRASWHCSTYCRGWGVCCCASTSSRGSAV
     240-373: Missing.

Show »
Length:239
Mass (Da):26,289
Checksum:i395AE297B79DF2D2
GO
Isoform 3 (identifier: Q86W33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-293: VYSLVVILPK...FGSEPKILFS → LCRCHNLPVL...RLCRRGGLPG
     294-373: Missing.

Note: No experimental confirmation available.
Show »
Length:293
Mass (Da):32,117
Checksum:i1EA2891404AAE4F5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti141 – 1422HL → TW in BAA89782 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei204 – 29390VYSLV…KILFS → LCRCHNLPVLQLLRSAHLRG FPPGLLRLGAQDPLLLQMPS GRDRGARCTPTPALRCGPAG GPGGCRGCWGLSCQLLEHAV RLCRRGGLPG in isoform 3. 1 PublicationVSP_016934Add
BLAST
Alternative sequencei204 – 23936VYSLV…LALLN → LGGASTCMRASWHCSTYCRG WGVCCCASTSSRGSAV in isoform 2. 1 PublicationVSP_016932Add
BLAST
Alternative sequencei240 – 373134Missing in isoform 2. 1 PublicationVSP_016933Add
BLAST
Alternative sequencei294 – 37380Missing in isoform 3. 1 PublicationVSP_016935Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037108 mRNA. Translation: BAA89782.1.
AF289568 mRNA. Translation: AAL55752.1.
AC023593 Genomic DNA. No translation available.
AC084035 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79343.1.
CH471052 Genomic DNA. Translation: EAW79344.1.
BC017058 mRNA. Translation: AAH17058.1.
BC050711 mRNA. Translation: AAH50711.1.
CCDSiCCDS3042.1. [Q86W33-1]
CCDS46899.1. [Q86W33-3]
RefSeqiNP_001129525.1. NM_001136053.2. [Q86W33-1]
NP_001136118.1. NM_001142646.2. [Q86W33-3]
XP_006713558.1. XM_006713495.3. [Q86W33-1]
XP_006713559.1. XM_006713496.2. [Q86W33-1]
XP_006713560.1. XM_006713497.3. [Q86W33-1]
XP_011510724.1. XM_011512422.1. [Q86W33-1]
UniGeneiHs.6418.

Genome annotation databases

EnsembliENST00000296210; ENSP00000296210; ENSG00000163870. [Q86W33-3]
ENST00000355552; ENSP00000347748; ENSG00000163870. [Q86W33-1]
ENST00000393400; ENSP00000377056; ENSG00000163870. [Q86W33-2]
ENST00000450633; ENSP00000413428; ENSG00000163870. [Q86W33-1]
ENST00000489960; ENSP00000418298; ENSG00000163870. [Q86W33-1]
GeneIDi131601.
KEGGihsa:131601.
UCSCiuc003ejn.4. human. [Q86W33-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037108 mRNA. Translation: BAA89782.1.
AF289568 mRNA. Translation: AAL55752.1.
AC023593 Genomic DNA. No translation available.
AC084035 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79343.1.
CH471052 Genomic DNA. Translation: EAW79344.1.
BC017058 mRNA. Translation: AAH17058.1.
BC050711 mRNA. Translation: AAH50711.1.
CCDSiCCDS3042.1. [Q86W33-1]
CCDS46899.1. [Q86W33-3]
RefSeqiNP_001129525.1. NM_001136053.2. [Q86W33-1]
NP_001136118.1. NM_001142646.2. [Q86W33-3]
XP_006713558.1. XM_006713495.3. [Q86W33-1]
XP_006713559.1. XM_006713496.2. [Q86W33-1]
XP_006713560.1. XM_006713497.3. [Q86W33-1]
XP_011510724.1. XM_011512422.1. [Q86W33-1]
UniGeneiHs.6418.

3D structure databases

ProteinModelPortaliQ86W33.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126289. 25 interactions.
STRINGi9606.ENSP00000347748.

PTM databases

iPTMnetiQ86W33.
PhosphoSiteiQ86W33.

Polymorphism and mutation databases

DMDMi74727643.

Proteomic databases

MaxQBiQ86W33.
PaxDbiQ86W33.
PeptideAtlasiQ86W33.
PRIDEiQ86W33.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296210; ENSP00000296210; ENSG00000163870. [Q86W33-3]
ENST00000355552; ENSP00000347748; ENSG00000163870. [Q86W33-1]
ENST00000393400; ENSP00000377056; ENSG00000163870. [Q86W33-2]
ENST00000450633; ENSP00000413428; ENSG00000163870. [Q86W33-1]
ENST00000489960; ENSP00000418298; ENSG00000163870. [Q86W33-1]
GeneIDi131601.
KEGGihsa:131601.
UCSCiuc003ejn.4. human. [Q86W33-1]

Organism-specific databases

CTDi131601.
GeneCardsiTPRA1.
HGNCiHGNC:30413. TPRA1.
HPAiHPA019784.
MIMi608336. gene.
neXtProtiNX_Q86W33.
PharmGKBiPA165698543.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4536. Eukaryota.
ENOG410XRXY. LUCA.
GeneTreeiENSGT00390000016807.
HOGENOMiHOG000112778.
HOVERGENiHBG081569.
InParanoidiQ86W33.
OMAiMFLLWKL.
OrthoDBiEOG091G074F.
PhylomeDBiQ86W33.
TreeFamiTF314072.

Miscellaneous databases

ChiTaRSiTPRA1. human.
GenomeRNAii131601.
PROiQ86W33.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163870.
CleanExiHS_GPR175.
ExpressionAtlasiQ86W33. baseline and differential.
GenevisibleiQ86W33. HS.

Family and domain databases

InterProiIPR018781. TPRA40.
[Graphical view]
PANTHERiPTHR15876. PTHR15876. 1 hit.
PfamiPF10160. Tmemb_40. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTPRA1_HUMAN
AccessioniPrimary (citable) accession number: Q86W33
Secondary accession number(s): A8MVB8
, D3DNA9, Q8WZ24, Q96AJ6, Q9P2R4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: June 1, 2003
Last modified: September 7, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.