Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 30

Gene

ZSCAN30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:G66-32734-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 30
Alternative name(s):
ZNF-WYM
Zinc finger protein 397 opposite strand
Zinc finger protein 397OS
Gene namesi
Name:ZSCAN30
Synonyms:ZNF397OS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:33517. ZSCAN30.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186814.
PharmGKBiPA165429212.

Polymorphism and mutation databases

BioMutaiZSCAN30.
DMDMi74759452.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003006941 – 494Zinc finger and SCAN domain-containing protein 30Add BLAST494

Proteomic databases

EPDiQ86W11.
MaxQBiQ86W11.
PaxDbiQ86W11.
PeptideAtlasiQ86W11.
PRIDEiQ86W11.

PTM databases

iPTMnetiQ86W11.
PhosphoSitePlusiQ86W11.

Expressioni

Gene expression databases

BgeeiENSG00000186814.
CleanExiHS_ZNF397OS.
ExpressionAtlasiQ86W11. baseline and differential.
GenevisibleiQ86W11. HS.

Organism-specific databases

HPAiHPA007289.

Interactioni

Protein-protein interaction databases

BioGridi755850. 6 interactors.
STRINGi9606.ENSP00000329738.

Structurei

3D structure databases

ProteinModelPortaliQ86W11.
SMRiQ86W11.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 130SCAN boxPROSITE-ProRule annotationAdd BLAST83

Sequence similaritiesi

Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri301 – 323C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri329 – 351C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri357 – 379C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri385 – 407C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri413 – 435C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri441 – 463C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri469 – 491C2H2-type 7PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOVERGENiHBG018163.
InParanoidiQ86W11.
KOiK09230.
OMAiRRIPTEH.
OrthoDBiEOG091G02KC.
PhylomeDBiQ86W11.
TreeFamiTF338304.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 4 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 7 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86W11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGEATVLAY HAPEEQEGLL VVKVEEENYV LDQDFGLQEN PWSQEVFRQK
60 70 80 90 100
FRQFSYSDST GPREALSRLR ELCCQWLRPE VHSKEQILEL LMLEQFLAIL
110 120 130 140 150
PEELQAWLRE HRPENGEEAV TMLEELEKEL EEPRQQDTTH GQEMFWQEMT
160 170 180 190 200
STGALKSLSL NSPVQPLENQ CKTETQESQA FQERDGRMVA GKVLMAKQEI
210 220 230 240 250
VECVASAAMI SPGKLPGETH SQRIAEEALG GLDNSKKQKG NAAGNKISQL
260 270 280 290 300
PSQDRHFSLA TFNRRIPTEH SVLESHESEG SFSMNSNDIT QQSVDTREKL
310 320 330 340 350
YECFDCGKAF CQSSKLIRHQ RIHTGERPYA CKECGKAFSL SSDLVRHQRI
360 370 380 390 400
HSGEKPYECC ECGKAFRGSS ELIRHRRIHT GEKPYECGEC GKAFSRSSAL
410 420 430 440 450
IQHKKIHTGD KSYECIACGK AFGRSSILIE HQRIHTGEKP YECNECGKSF
460 470 480 490
NQSSALTQHQ RIHTGEKPYE CSECRKTFRH RSGLMQHQRT HTRV
Length:494
Mass (Da):56,364
Last modified:June 1, 2003 - v1
Checksum:i04D07EE957654505
GO
Isoform 2 (identifier: Q86W11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: RMVAGKVLMAKQEIVECVASAAMISPGKLPGETHS → VSLCHPGWSAVVQPQLTAVALNPWVKVILLPQPPE
     222-494: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,499
Checksum:i4A2EFB9154A4A8B0
GO

Sequence cautioni

The sequence AAL26786 differs from that shown. Probable cloning artifact.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059914238Q → P.Corresponds to variant rs2249769dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027861187 – 221RMVAG…GETHS → VSLCHPGWSAVVQPQLTAVA LNPWVKVILLPQPPE in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_027862222 – 494Missing in isoform 2. 1 PublicationAdd BLAST273

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY234408 mRNA. Translation: AAO89074.1.
AK131291 mRNA. Translation: BAD18462.1.
AK303447 mRNA. Translation: BAG64492.1.
CH471088 Genomic DNA. Translation: EAX01344.1.
AF303374 mRNA. Translation: AAL26786.1. Sequence problems.
CCDSiCCDS42427.1. [Q86W11-1]
RefSeqiNP_001106205.1. NM_001112734.3. [Q86W11-1]
NP_001159484.1. NM_001166012.2. [Q86W11-1]
NP_001275640.1. NM_001288711.1.
XP_005258240.1. XM_005258183.4.
XP_006722434.1. XM_006722371.3. [Q86W11-1]
XP_011524091.1. XM_011525789.2.
XP_016881004.1. XM_017025515.1. [Q86W11-1]
XP_016881008.1. XM_017025519.1.
XP_016881009.1. XM_017025520.1.
XP_016881010.1. XM_017025521.1.
XP_016881011.1. XM_017025522.1.
UniGeneiHs.619840.

Genome annotation databases

EnsembliENST00000333206; ENSP00000329738; ENSG00000186814. [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814. [Q86W11-1]
GeneIDi100101467.
KEGGihsa:100101467.
UCSCiuc002kyl.5. human. [Q86W11-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY234408 mRNA. Translation: AAO89074.1.
AK131291 mRNA. Translation: BAD18462.1.
AK303447 mRNA. Translation: BAG64492.1.
CH471088 Genomic DNA. Translation: EAX01344.1.
AF303374 mRNA. Translation: AAL26786.1. Sequence problems.
CCDSiCCDS42427.1. [Q86W11-1]
RefSeqiNP_001106205.1. NM_001112734.3. [Q86W11-1]
NP_001159484.1. NM_001166012.2. [Q86W11-1]
NP_001275640.1. NM_001288711.1.
XP_005258240.1. XM_005258183.4.
XP_006722434.1. XM_006722371.3. [Q86W11-1]
XP_011524091.1. XM_011525789.2.
XP_016881004.1. XM_017025515.1. [Q86W11-1]
XP_016881008.1. XM_017025519.1.
XP_016881009.1. XM_017025520.1.
XP_016881010.1. XM_017025521.1.
XP_016881011.1. XM_017025522.1.
UniGeneiHs.619840.

3D structure databases

ProteinModelPortaliQ86W11.
SMRiQ86W11.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi755850. 6 interactors.
STRINGi9606.ENSP00000329738.

PTM databases

iPTMnetiQ86W11.
PhosphoSitePlusiQ86W11.

Polymorphism and mutation databases

BioMutaiZSCAN30.
DMDMi74759452.

Proteomic databases

EPDiQ86W11.
MaxQBiQ86W11.
PaxDbiQ86W11.
PeptideAtlasiQ86W11.
PRIDEiQ86W11.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333206; ENSP00000329738; ENSG00000186814. [Q86W11-1]
ENST00000420878; ENSP00000392371; ENSG00000186814. [Q86W11-1]
GeneIDi100101467.
KEGGihsa:100101467.
UCSCiuc002kyl.5. human. [Q86W11-1]

Organism-specific databases

CTDi100101467.
GeneCardsiZSCAN30.
HGNCiHGNC:33517. ZSCAN30.
HPAiHPA007289.
neXtProtiNX_Q86W11.
OpenTargetsiENSG00000186814.
PharmGKBiPA165429212.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOVERGENiHBG018163.
InParanoidiQ86W11.
KOiK09230.
OMAiRRIPTEH.
OrthoDBiEOG091G02KC.
PhylomeDBiQ86W11.
TreeFamiTF338304.

Enzyme and pathway databases

BioCyciZFISH:G66-32734-MONOMER.

Miscellaneous databases

ChiTaRSiZSCAN30. human.
GenomeRNAii100101467.
PROiQ86W11.

Gene expression databases

BgeeiENSG00000186814.
CleanExiHS_ZNF397OS.
ExpressionAtlasiQ86W11. baseline and differential.
GenevisibleiQ86W11. HS.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 4 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 7 hits.
PS50157. ZINC_FINGER_C2H2_2. 7 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZSC30_HUMAN
AccessioniPrimary (citable) accession number: Q86W11
Secondary accession number(s): B4E0N0, Q6ZNB3, Q96PN3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.