Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Immunoglobulin-like and fibronectin type III domain-containing protein 1

Gene

IGFN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Immunoglobulin-like and fibronectin type III domain-containing protein 1
Alternative name(s):
EEF1A2-binding protein 1
KY-interacting protein 1
Gene namesi
Name:IGFN1
Synonyms:EEF1A2BP1, KYIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24607. IGFN1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiIGFN1.
DMDMi205785468.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12511251Immunoglobulin-like and fibronectin type III domain-containing protein 1PRO_0000347186Add
BLAST

Proteomic databases

EPDiQ86VF2.
MaxQBiQ86VF2.
PaxDbiQ86VF2.
PRIDEiQ86VF2.

PTM databases

iPTMnetiQ86VF2.
PhosphoSiteiQ86VF2.

Expressioni

Tissue specificityi

Expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiQ86VF2.
CleanExiHS_IGFN1.
ExpressionAtlasiQ86VF2. baseline and differential.
GenevisibleiQ86VF2. HS.

Interactioni

Subunit structurei

Interacts with FLNC (By similarity). Interacts with KY.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MEOX2A4D1273EBI-10259767,EBI-10172134

Protein-protein interaction databases

BioGridi124802. 1 interaction.
IntActiQ86VF2. 2 interactions.
STRINGi9606.ENSP00000334714.

Structurei

3D structure databases

ProteinModelPortaliQ86VF2.
SMRiQ86VF2. Positions 27-121, 263-292, 457-1250.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini29 – 11991Ig-like 1Add
BLAST
Domaini309 – 39890Ig-like 2Add
BLAST
Domaini454 – 53986Ig-like 3Add
BLAST
Domaini646 – 74196Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini746 – 845100Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini847 – 94296Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini946 – 103085Ig-like 4Add
BLAST
Domaini1043 – 113795Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST
Domaini1151 – 124595Ig-like 5Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili188 – 22134Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiKOG0613. Eukaryota.
ENOG410XQFD. LUCA.
GeneTreeiENSGT00840000129685.
HOGENOMiHOG000081787.
HOVERGENiHBG107993.
InParanoidiQ86VF2.
OMAiLGGSEEM.
OrthoDBiEOG76DTRM.
PhylomeDBiQ86VF2.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF00041. fn3. 4 hits.
PF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 7 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 7 hits.
SSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86VF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGKLRKSHI PGVSIWQLVE EIPEGCSTPD FEQKPVTSAL PEGKNAVFRA
60 70 80 90 100
VVCGEPRPEV RWQNSKGDLS DSSKYKISSS PGSKEHVLQI NKLTGEDTDL
110 120 130 140 150
YRCTAVNAYG EAACSVRLTV IEVGFRKNRK RHREPQEDLR KELMDFRKLL
160 170 180 190 200
KKRAPPAPKK KMDLEQIWQL LMTADRKDYE KICLKYGIVD YRGMLRRLQE
210 220 230 240 250
MKKEQEDKMA QYINTISSLR HIRVTKDGNA KFDLELDLKD SQSKIYLYKD
260 270 280 290 300
GEMIPYGFNN QTKHCLRRLG KRYEFQIQDL RPEDSGIYQV KVEDAVVFST
310 320 330 340 350
ELEASAIPPR VVVPLAETHC EEQGDAVFEC TLSSPCPSAA WHFRHRLLHP
360 370 380 390 400
SDKYEVYVSP DGLTHRLVVR GARFSDMGPY SLGTGLYTSS AWLVVEAGKD
410 420 430 440 450
KDLQSTSADH KLQSRRSGKD GRLDIYGERR DATRSSTSRY KPGTGSFSKD
460 470 480 490 500
AQGPMGHFSQ GLADMEVQPG EAATLSCTLT SDLGPGTWFK DGVKLTTQDG
510 520 530 540 550
VIFKQDGLVH SLFITHVQGT QAGRYTFVAG DQQSEATLTV QDSPTIAPDV
560 570 580 590 600
TEKLREPLVV KAGKPVIVKI PFQSHLPIQA AWRKDGAEVV GSSDREAQVD
610 620 630 640 650
LGDGYTRLCL PSAGRKDCGQ YSVTLRSEGG SVQAELTLQV IDKPDPPQGP
660 670 680 690 700
MEVQDCHRAG VCLRWRPPRD NGGRTVECYV VERRQAGRST WLKVGEAPAD
710 720 730 740 750
STTFTDAHVE PGRKYTFRVR AVTSEGAGEA LESEEILVAP EALPKAPSAP
760 770 780 790 800
AILSASSQGI TLTWTAPRGP GSAHILGYLI ERRKKGSNTW TAVNDQPVPE
810 820 830 840 850
RRWTVADVRQ GCQYEFRVTA VAPSGPGEPG PPSDAVFARD PMRPPGLVRN
860 870 880 890 900
LQVTDRSNTS ITLSWAGPDT QEGDEAQGYV VELCSSDSLQ WLPCHVGTVP
910 920 930 940 950
VTTYTAKGLR PGEGYFVRVT AVNEGGQSQP SALDTLVQAM PVTVCPKFLV
960 970 980 990 1000
DSSTKDLLTV KVGDTVRVPV SFEAMPMPEV TWLKDGLPLP KRSVTVTKDG
1010 1020 1030 1040 1050
LTQLLIPVAG LSDSGLYTVV LRTLQGKEVA HSFRIRVAAC PQAPGPIHLQ
1060 1070 1080 1090 1100
ENVPGTVTAE WEPSPDEAQD VPLHYAVFTR SSAHGPWHEA ADRIHTNRFT
1110 1120 1130 1140 1150
LLGILPGHEY HFRVVAKNEL GASKPSDTSQ PWCIPRQRDR FTVKAPCYRE
1160 1170 1180 1190 1200
PDLSQKPRFL VGLRSHLLPQ GCECCMSCAV QGSPRPHVTW FKNDRSLEGN
1210 1220 1230 1240 1250
PAVYSTDLLG VCSLTIPSVS PKDSGEYKAV AENTLGQAVS TATLIVIEPS

T
Length:1,251
Mass (Da):137,763
Last modified:September 2, 2008 - v2
Checksum:i1730143C58C58DAF
GO
Isoform 2 (identifier: Q86VF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-383: Missing.
     384-413: TGLYTSSAWLVVEAGKDKDLQSTSADHKLQ → MGWQPMGENWGCLEEMLNEDQSREPPGHLG

Show »
Length:868
Mass (Da):94,050
Checksum:iBB8DB9DC20C96C8C
GO
Isoform 3 (identifier: Q86VF2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-383: Missing.
     384-413: TGLYTSSAWLVVEAGKDKDLQSTSADHKLQ → MGWQPMGENWGCLEEMLNEDQSREPPGHLG
     974-988: AMPMPEVTWLKDGLP → HARRPLGPSTCRRTC
     989-1251: Missing.

Note: No experimental confirmation available.
Show »
Length:605
Mass (Da):65,359
Checksum:iA89D34F853AAA7DC
GO
Isoform 4 (identifier: Q86VF2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     566-570: VIVKI → IQTYH
     571-1251: Missing.

Note: No experimental confirmation available.
Show »
Length:570
Mass (Da):64,070
Checksum:i29437D5DEA9DBD08
GO
Isoform 5 (identifier: Q86VF2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-413: Q → QRQGAQASGA...QSREPPGHLG

Note: No experimental confirmation available.
Show »
Length:3,708
Mass (Da):383,805
Checksum:i8E8A7AB25FB2C2F7
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1056 – 10561T → M.
Corresponds to variant rs6690992 [ dbSNP | Ensembl ].
VAR_046035
Natural varianti1095 – 10951H → Y.3 Publications
Corresponds to variant rs3738270 [ dbSNP | Ensembl ].
VAR_046036

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 383383Missing in isoform 2 and isoform 3. 3 PublicationsVSP_035055Add
BLAST
Alternative sequencei384 – 41330TGLYT…DHKLQ → MGWQPMGENWGCLEEMLNED QSREPPGHLG in isoform 2 and isoform 3. 3 PublicationsVSP_035056Add
BLAST
Alternative sequencei413 – 4131Q → QRQGAQASGAEESGSIESQG EKSREQGPRGGSLEGAGPAS GLQHIASPDRDGLGRHGYSL MGDKGTADSAWGPGQEGEGF PVAEGSRATLPRENQSHREG GWARSLAERPHLQGESSESG LGLPEKQQQDRGRDSNSDEC WRKAGGWEAGSSRLQAGGLG SSREGKEHRGDSGRQLDRHA PEQLWDARLGPGRGKSDLQG CQSDPVGSWPRGKQIEISQD DSLAEMDRGDAPSRERGRGI VVWGGGTGLGEAGDSNGAGG PGTLELTGGRGSGSKVGMAP ESWGSQGGRDADYGEARGYW GSGELLEQIPGGKDFQEPSI SGGRKFLLGDGSPEIKAEDS LQEADGICRGESVVTGSAYK TGPGGPGDPRGCEGVLQELR GRDGQETAWASGEVEYDPRS FQSSQGWTAGHRAAGGIGRI ESKGTSPWDDTPSSLRKTGA HHGPGVLGPSGGQEGMGGIW VAGLTESGQGVDARSHWLSR APGLGAQGSGGTLGDKKGLR GPGSIGSEPDFWNGSGSSRV KGPRGETGYKDGLEGPGRME SRYEGGLGYSREISSKSGAG YSYGSGVPGEMGSGHGAGCR VSPRAPAGVESEEGGGYRHG SGAPGGVWSGNEDSGPAGGG SGRVASLKNGSGGPDGAPMN DTRNWASACQAGMDPRGGHH SDGGLGSPGVTGSAGRGGLK APGVVETVGMGCVEAEPESS GRIRPWGQTGNYGGFRASEA LGAFGEGGYEDGSGGPGAMG PGSLRAGSKVGEGDGTRCPG AKASGAGAGYRDDTRHPESL APHNGAASGSQWAYGAGNVL GYEDGSELPGPQGTGVRTAY GERSRGLGPRSTGPGGEAGF RDGSGGLQGMGSADGPGCRK GIGSSGEMGSVDKEGYKKDL GAPENMGSGSKADYRDGVGG SGAMGSMDEAGYRKDLGAPE GISSGSKADYRGGLQDSREA GSGSKADYSGGLKGSREIGS MDETDNRKDLGVPEGMGAGY RAGLRGPGEMGSLDESGHRN GIGGYGEMGSGYREDLGAPE GMGTGSKAGYRDGLRGSGEM RSMDEAGYRKNLGAPERMDS GSKAGYRGGLRGSGEMGLIE AGYRKDLGVSEGGGSGSKAG YRGGLGSGEMGSVDKAGYRK DLGASEAIGSGSKAGFTDGL GGSEEMGSVNKAGYRKDLGA PKGMGSGSKASFRDGLGGSG EMGSVNEAGYRKDLGVPEGI GSGSKAGFRDGLGGSEEMGS VNKAGYRKDLGAPKGIGSGS KAGFRDGLGSSGEMGSMDEA GYRKNLGAPEGIGSGSKAGF RDGLGSSVEMGSVNEAGYRK DLGAPEGMGSGSKAGFRDGL GGSGEMGSVNEAGYRKDLGA PKGIGSGSKADFRDALGSSG EMGSMDEAGYRKDLWAPEGI GSGSKAGFRDGLGSSVEMGS VNEAGYRKDLGAPEGMGSGS KAGFRDGLGGSGEMGSVNEA GYRKDLGAPKGIGSGSKADF RDALGSSGEMGSMDEAGYRK DLWAPEGIGSGSKAGFRDGL GSSVEMGSVNEAGYRKDLGA PEGMGSGSKEGFRDGLGGSE EMGSVNKAGYRKDLGAPKGM GSGSKEGFRDGLGGSEEMGS MDEAGYRKDLGAPEGIGSGS KAGFRDGLGGSEEMRSMDEA GYRKDLGAPERIGSGSKAGF RDGLGSSVEMGSVNEAGYRK DLGAPKGMGSGSKTGFRDGL GGSEEMESMDEAGYRKDLGA PEGIGSGSKAGFRDGLGSST EMGSVNEAGYRKDLGAPKGM GSESKAGFRDGLGSSGEMGS MDEAGYRKDLGAPEGMGSGS KAGFRDGLGGSEEMGSVNKA GYRKDLGAPKGMGSGSKAGF RDGLGSSGEMGSMDEADYRK DLGAPEEMGSGSYTDYRNGL GSSGKISSGDEAGYKNVLGG SGRNPLGSEAGSRGSLEDSG YILSWNEAGSRQGFGGTSGM GSGSEVSYRGGSGGSGETGP EGKMGYGDGSGRLGVPGSLA GIGHEAGPRGHKAMGHRSGY WVASEGDTNSKDGPERARET RLVDGAGPGVEPGMAGMPGT AGGMAHRDSLRGTGVLGSQG GRQTLSDERGSTKDLGGYGT SGIPEASEAAGAKGKPDVKE WQDSSGTPGSSRDRGAPRVK DRSPDQAGIMGASGFLDGKG AVEGETWAGMAALGSGYERD IWKAGPGMTDRGRVAGQGGL ASQGGGDSLLGGRRVGSGSS VGTGQDLDSGSMPGGRGKST SGPADRQGTSNAWAPDWENQ GFSQGSIDAGKQPAGSRASG SLQEKDAAFGGTHEGPGGFK GGEGAPGQEAAGGCRSPWSL DSKGSSPGRGSSVDAEDSGI LGKGNSTEWGNALTPKPGES GPQGAWNGLDGPFGRKASRD RSGGTQDLSSQRGKGQRGGK RSLGEQGSLEAENGEVQGPG ALKEDEGQGVEEAGRSGRRP GSLRSRSQAQSGAEVGGGKR RGADEAGSMGWQPMGENWGC LEEMLNEDQSREPPGHLG in isoform 5. CuratedVSP_045740
Alternative sequencei566 – 5705VIVKI → IQTYH in isoform 4. 1 PublicationVSP_035057
Alternative sequencei571 – 1251681Missing in isoform 4. 1 PublicationVSP_035058Add
BLAST
Alternative sequencei974 – 98815AMPMP…KDGLP → HARRPLGPSTCRRTC in isoform 3. 1 PublicationVSP_035059Add
BLAST
Alternative sequencei989 – 1251263Missing in isoform 3. 1 PublicationVSP_035060Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY245430 mRNA. Translation: AAO92932.1.
AL137493 Transcribed RNA. Translation: CAB70770.2.
AC103925 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91347.1.
BC033185 mRNA. No translation available.
BC131529 mRNA. Translation: AAI31530.1.
CCDSiCCDS53455.1. [Q86VF2-5]
PIRiT46475.
RefSeqiNP_001158058.1. NM_001164586.1. [Q86VF2-5]
XP_011508422.1. XM_011510120.1. [Q86VF2-5]
XP_011508423.1. XM_011510121.1. [Q86VF2-5]
UniGeneiHs.519024.

Genome annotation databases

EnsembliENST00000295591; ENSP00000295591; ENSG00000163395. [Q86VF2-1]
ENST00000335211; ENSP00000334714; ENSG00000163395. [Q86VF2-5]
ENST00000437879; ENSP00000399041; ENSG00000163395. [Q86VF2-4]
GeneIDi91156.
KEGGihsa:91156.
UCSCiuc001gwc.3. human. [Q86VF2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY245430 mRNA. Translation: AAO92932.1.
AL137493 Transcribed RNA. Translation: CAB70770.2.
AC103925 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91347.1.
BC033185 mRNA. No translation available.
BC131529 mRNA. Translation: AAI31530.1.
CCDSiCCDS53455.1. [Q86VF2-5]
PIRiT46475.
RefSeqiNP_001158058.1. NM_001164586.1. [Q86VF2-5]
XP_011508422.1. XM_011510120.1. [Q86VF2-5]
XP_011508423.1. XM_011510121.1. [Q86VF2-5]
UniGeneiHs.519024.

3D structure databases

ProteinModelPortaliQ86VF2.
SMRiQ86VF2. Positions 27-121, 263-292, 457-1250.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124802. 1 interaction.
IntActiQ86VF2. 2 interactions.
STRINGi9606.ENSP00000334714.

PTM databases

iPTMnetiQ86VF2.
PhosphoSiteiQ86VF2.

Polymorphism and mutation databases

BioMutaiIGFN1.
DMDMi205785468.

Proteomic databases

EPDiQ86VF2.
MaxQBiQ86VF2.
PaxDbiQ86VF2.
PRIDEiQ86VF2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295591; ENSP00000295591; ENSG00000163395. [Q86VF2-1]
ENST00000335211; ENSP00000334714; ENSG00000163395. [Q86VF2-5]
ENST00000437879; ENSP00000399041; ENSG00000163395. [Q86VF2-4]
GeneIDi91156.
KEGGihsa:91156.
UCSCiuc001gwc.3. human. [Q86VF2-1]

Organism-specific databases

CTDi91156.
GeneCardsiIGFN1.
H-InvDBHIX0001455.
HGNCiHGNC:24607. IGFN1.
neXtProtiNX_Q86VF2.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0613. Eukaryota.
ENOG410XQFD. LUCA.
GeneTreeiENSGT00840000129685.
HOGENOMiHOG000081787.
HOVERGENiHBG107993.
InParanoidiQ86VF2.
OMAiLGGSEEM.
OrthoDBiEOG76DTRM.
PhylomeDBiQ86VF2.

Miscellaneous databases

ChiTaRSiIGFN1. human.
GenomeRNAii91156.
PROiQ86VF2.

Gene expression databases

BgeeiQ86VF2.
CleanExiHS_IGFN1.
ExpressionAtlasiQ86VF2. baseline and differential.
GenevisibleiQ86VF2. HS.

Family and domain databases

Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF00041. fn3. 4 hits.
PF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 7 hits.
SM00408. IGc2. 4 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 7 hits.
SSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Skeletal muscle specific eEF1A2 binding protein."
    Mansilla F., Garcia C.A., Knudsen C.R., Clark B.F.C.
    Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT TYR-1095.
    Tissue: Skeletal muscle.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT TYR-1095.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT TYR-1095.
  6. "Filamin C interacts with the muscular dystrophy KY protein and is abnormally distributed in mouse KY deficient muscle fibres."
    Beatham J., Romero R., Townsend S.K.M., Hacker T., van der Ven P.F.M., Blanco G.
    Hum. Mol. Genet. 13:2863-2874(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KY, TISSUE SPECIFICITY.

Entry informationi

Entry nameiIGFN1_HUMAN
AccessioniPrimary (citable) accession number: Q86VF2
Secondary accession number(s): F8WAI1, Q9NT72
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: September 2, 2008
Last modified: June 8, 2016
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.