Q86VE9 (SERC5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine incorporator 5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes By similarity. Ref.1 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain. Ref.1 |
| Sequence similarities | Belongs to the TDE1 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86VE9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86VE9-2) The sequence of this isoform differs from the canonical sequence as follows: 413-416: NHVR → K | ||||||
| Isoform 3 (identifier: Q86VE9-3) The sequence of this isoform differs from the canonical sequence as follows: 413-423: NHVRSAFHLLP → KNYQC | ||||||
| Isoform 4 (identifier: Q86VE9-4) The sequence of this isoform differs from the canonical sequence as follows: 414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 423 | 423 | Serine incorporator 5 | PRO_0000330630 | |||||
Regions | |||||||||
| Topological domain | 1 – 36 | 36 | Extracellular Potential | ||||||
| Transmembrane | 37 – 57 | 21 | Helical; Potential | ||||||
| Topological domain | 58 – 89 | 32 | Cytoplasmic Potential | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Potential | ||||||
| Topological domain | 111 – 124 | 14 | Extracellular Potential | ||||||
| Transmembrane | 125 – 145 | 21 | Helical; Potential | ||||||
| Topological domain | 146 – 156 | 11 | Cytoplasmic Potential | ||||||
| Transmembrane | 157 – 177 | 21 | Helical; Potential | ||||||
| Topological domain | 178 – 198 | 21 | Extracellular Potential | ||||||
| Transmembrane | 199 – 219 | 21 | Helical; Potential | ||||||
| Topological domain | 220 – 230 | 11 | Cytoplasmic Potential | ||||||
| Transmembrane | 231 – 251 | 21 | Helical; Potential | ||||||
| Topological domain | 252 – 258 | 7 | Extracellular Potential | ||||||
| Transmembrane | 259 – 279 | 21 | Helical; Potential | ||||||
| Topological domain | 280 – 311 | 32 | Cytoplasmic Potential | ||||||
| Transmembrane | 312 – 332 | 21 | Helical; Potential | ||||||
| Topological domain | 333 – 385 | 53 | Extracellular Potential | ||||||
| Transmembrane | 386 – 406 | 21 | Helical; Potential | ||||||
| Topological domain | 407 – 423 | 17 | Cytoplasmic Potential | ||||||
| Compositional bias | 5 – 26 | 22 | Cys-rich | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 113 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 183 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 413 – 423 | 11 | NHVRSAFHLLP → KNYQC in isoform 3. | VSP_033054 | |||||
| Alternative sequence | 413 – 416 | 4 | NHVR → K in isoform 2. | VSP_033055 | |||||
| Alternative sequence | 414 – 423 | 10 | HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4. | VSP_042310 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF498273 mRNA. Translation: AAP06800.1. AK297467 mRNA. Translation: BAG59889.1. AC010260 Genomic DNA. No translation available. AC012636 Genomic DNA. No translation available. CH471084 Genomic DNA. Translation: EAW95843.1. CH471084 Genomic DNA. Translation: EAW95844.1. CH471084 Genomic DNA. Translation: EAW95845.1. BC101280 mRNA. Translation: AAI01281.1. BC101281 mRNA. Translation: AAI01282.1. BC101283 mRNA. Translation: AAI01284.1. |
| IPI | IPI00890708. IPI00966609. IPI00966938. |
| RefSeq | NP_001167542.1. NM_001174071.1. NP_001167543.1. NM_001174072.1. NP_840060.1. NM_178276.5. |
| UniGene | Hs.288232. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-47313N. |
| STRING | 9606.ENSP00000406585. |
PTM databases | |
| PhosphoSite | Q86VE9. |
Polymorphism databases | |
| DMDM | 74714045. |
Proteomic databases | |
| PaxDb | Q86VE9. |
| PRIDE | Q86VE9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000507668; ENSP00000426237; ENSG00000164300. ENST00000512721; ENSP00000420863; ENSG00000164300. ENST00000512972; ENSP00000421665; ENSG00000164300. |
| GeneID | 256987. |
| KEGG | hsa:256987. |
| UCSC | uc003kgj.3. human. uc003kgm.3. human. |
Organism-specific databases | |
| CTD | 256987. |
| GeneCards | GC05M079407. |
| HGNC | HGNC:18825. SERINC5. |
| HPA | HPA037898. |
| MIM | 614551. gene. |
| neXtProt | NX_Q86VE9. |
| PharmGKB | PA38698. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG247442. |
| HOGENOM | HOG000165463. |
| HOVERGEN | HBG025699. |
| InParanoid | Q86VE9. |
| OMA | SIFWVKM. |
| OrthoDB | EOG4D26PW. |
Gene expression databases | |
| ArrayExpress | Q86VE9. |
| Bgee | Q86VE9. |
| CleanEx | HS_SERINC5. |
| Genevestigator | Q86VE9. |
Family and domain databases | |
| InterPro | IPR005016. TMS_TDE. IPR015460. TPO1. [Graphical view] |
| PANTHER | PTHR10383. PTHR10383. 1 hit. PTHR10383:SF4. PTHR10383:SF4. 1 hit. |
| Pfam | PF03348. Serinc. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SERINC5. human. |
| GenomeRNAi | 256987. |
| NextBio | 92895. |
| SOURCE | Search... |
Entry information
| Entry name | SERC5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86VE9 Secondary accession number(s): B4DMH7, Q495A4, Q495A6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
