Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine incorporator 5

Gene

SERINC5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734). Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes (By similarity).By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Antiviral defense, Host-virus interaction, Immunity, Innate immunity, Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-977347. Serine biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine incorporator 5Curated
Gene namesi
Name:SERINC5Imported
Synonyms:C5orf12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:18825. SERINC5.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 36ExtracellularSequence analysisAdd BLAST36
Transmembranei37 – 57HelicalSequence analysisAdd BLAST21
Topological domaini58 – 89CytoplasmicSequence analysisAdd BLAST32
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Topological domaini111 – 124ExtracellularSequence analysisAdd BLAST14
Transmembranei125 – 145HelicalSequence analysisAdd BLAST21
Topological domaini146 – 156CytoplasmicSequence analysisAdd BLAST11
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 198ExtracellularSequence analysisAdd BLAST21
Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 230CytoplasmicSequence analysisAdd BLAST11
Transmembranei231 – 251HelicalSequence analysisAdd BLAST21
Topological domaini252 – 258ExtracellularSequence analysis7
Transmembranei259 – 279HelicalSequence analysisAdd BLAST21
Topological domaini280 – 311CytoplasmicSequence analysisAdd BLAST32
Transmembranei312 – 332HelicalSequence analysisAdd BLAST21
Topological domaini333 – 385ExtracellularSequence analysisAdd BLAST53
Transmembranei386 – 406HelicalSequence analysisAdd BLAST21
Topological domaini407 – 423CytoplasmicSequence analysisAdd BLAST17

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • Golgi apparatus Source: Ensembl
  • integral component of membrane Source: GO_Central
  • myelin sheath Source: Ensembl
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi256987.
OpenTargetsiENSG00000164300.
PharmGKBiPA38698.

Polymorphism and mutation databases

BioMutaiSERINC5.
DMDMi74714045.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003306301 – 423Serine incorporator 5Add BLAST423

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi113N-linked (GlcNAc...)Sequence analysis1
Glycosylationi183N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ86VE9.
PaxDbiQ86VE9.
PeptideAtlasiQ86VE9.
PRIDEiQ86VE9.

PTM databases

iPTMnetiQ86VE9.
PhosphoSitePlusiQ86VE9.

Expressioni

Tissue specificityi

Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain.1 Publication

Gene expression databases

BgeeiENSG00000164300.
CleanExiHS_SERINC5.
ExpressionAtlasiQ86VE9. baseline and differential.
GenevisibleiQ86VE9. HS.

Organism-specific databases

HPAiHPA037898.
HPA037899.

Interactioni

Protein-protein interaction databases

DIPiDIP-47313N.
IntActiQ86VE9. 1 interactor.
STRINGi9606.ENSP00000420863.

Structurei

3D structure databases

ProteinModelPortaliQ86VE9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 26Cys-richAdd BLAST22

Sequence similaritiesi

Belongs to the TDE1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2592. Eukaryota.
ENOG410XP7K. LUCA.
GeneTreeiENSGT00550000074522.
HOGENOMiHOG000165463.
HOVERGENiHBG025699.
InParanoidiQ86VE9.
OMAiCCPTREF.
OrthoDBiEOG091G06BW.
PhylomeDBiQ86VE9.
TreeFamiTF312881.

Family and domain databases

InterProiIPR029555. Serinc5.
IPR005016. TDE1/TMS.
[Graphical view]
PANTHERiPTHR10383. PTHR10383. 1 hit.
PTHR10383:SF16. PTHR10383:SF16. 1 hit.
PfamiPF03348. Serinc. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86VE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAQCCAGQL ACCCGSAGCS LCCDCCPRIR QSLSTRFMYA LYFILVVVLC
60 70 80 90 100
CIMMSTTVAH KMKEHIPFFE DMCKGIKAGD TCEKLVGYSA VYRVCFGMAC
110 120 130 140 150
FFFIFCLLTL KINNSKSCRA HIHNGFWFFK LLLLGAMCSG AFFIPDQDTF
160 170 180 190 200
LNAWRYVGAV GGFLFIGIQL LLLVEFAHKW NKNWTAGTAS NKLWYASLAL
210 220 230 240 250
VTLIMYSIAT GGLVLMAVFY TQKDSCMENK ILLGVNGGLC LLISLVAISP
260 270 280 290 300
WVQNRQPHSG LLQSGVISCY VTYLTFSALS SKPAEVVLDE HGKNVTICVP
310 320 330 340 350
DFGQDLYRDE NLVTILGTSL LIGCILYSCL TSTTRSSSDA LQGRYAAPEL
360 370 380 390 400
EIARCCFCFS PGGEDTEEQQ PGKEGPRVIY DEKKGTVYIY SYFHFVFFLA
410 420
SLYVMMTVTN WFNHVRSAFH LLP
Length:423
Mass (Da):47,009
Last modified:June 1, 2003 - v1
Checksum:iB05A461D418D049B
GO
Isoform 2 (identifier: Q86VE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-416: NHVR → K

Show »
Length:420
Mass (Da):46,631
Checksum:i8ACF67E0D648341F
GO
Isoform 3 (identifier: Q86VE9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-423: NHVRSAFHLLP → KNYQC

Show »
Length:417
Mass (Da):46,373
Checksum:iBF994EA5EFBEEDC7
GO
Isoform 4 (identifier: Q86VE9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV

Show »
Length:461
Mass (Da):51,335
Checksum:i3B74F5AA1944E437
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033054413 – 423NHVRSAFHLLP → KNYQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033055413 – 416NHVR → K in isoform 2. 1 Publication4
Alternative sequenceiVSP_042310414 – 423HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF498273 mRNA. Translation: AAP06800.1.
AK297467 mRNA. Translation: BAG59889.1.
AC010260 Genomic DNA. No translation available.
AC012636 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95843.1.
CH471084 Genomic DNA. Translation: EAW95844.1.
CH471084 Genomic DNA. Translation: EAW95845.1.
BC101280 mRNA. Translation: AAI01281.1.
BC101281 mRNA. Translation: AAI01282.1.
BC101283 mRNA. Translation: AAI01284.1.
CCDSiCCDS54874.1. [Q86VE9-4]
CCDS83009.1. [Q86VE9-2]
RefSeqiNP_001167542.1. NM_001174071.2. [Q86VE9-2]
NP_001167543.1. NM_001174072.2. [Q86VE9-4]
NP_840060.1. NM_178276.6. [Q86VE9-1]
UniGeneiHs.288232.

Genome annotation databases

EnsembliENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-4]
ENST00000509193; ENSP00000426134; ENSG00000164300. [Q86VE9-2]
ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
GeneIDi256987.
KEGGihsa:256987.
UCSCiuc011ctj.2. human. [Q86VE9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF498273 mRNA. Translation: AAP06800.1.
AK297467 mRNA. Translation: BAG59889.1.
AC010260 Genomic DNA. No translation available.
AC012636 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95843.1.
CH471084 Genomic DNA. Translation: EAW95844.1.
CH471084 Genomic DNA. Translation: EAW95845.1.
BC101280 mRNA. Translation: AAI01281.1.
BC101281 mRNA. Translation: AAI01282.1.
BC101283 mRNA. Translation: AAI01284.1.
CCDSiCCDS54874.1. [Q86VE9-4]
CCDS83009.1. [Q86VE9-2]
RefSeqiNP_001167542.1. NM_001174071.2. [Q86VE9-2]
NP_001167543.1. NM_001174072.2. [Q86VE9-4]
NP_840060.1. NM_178276.6. [Q86VE9-1]
UniGeneiHs.288232.

3D structure databases

ProteinModelPortaliQ86VE9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-47313N.
IntActiQ86VE9. 1 interactor.
STRINGi9606.ENSP00000420863.

PTM databases

iPTMnetiQ86VE9.
PhosphoSitePlusiQ86VE9.

Polymorphism and mutation databases

BioMutaiSERINC5.
DMDMi74714045.

Proteomic databases

MaxQBiQ86VE9.
PaxDbiQ86VE9.
PeptideAtlasiQ86VE9.
PRIDEiQ86VE9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-4]
ENST00000509193; ENSP00000426134; ENSG00000164300. [Q86VE9-2]
ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
GeneIDi256987.
KEGGihsa:256987.
UCSCiuc011ctj.2. human. [Q86VE9-1]

Organism-specific databases

CTDi256987.
DisGeNETi256987.
GeneCardsiSERINC5.
HGNCiHGNC:18825. SERINC5.
HPAiHPA037898.
HPA037899.
MIMi614551. gene.
neXtProtiNX_Q86VE9.
OpenTargetsiENSG00000164300.
PharmGKBiPA38698.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2592. Eukaryota.
ENOG410XP7K. LUCA.
GeneTreeiENSGT00550000074522.
HOGENOMiHOG000165463.
HOVERGENiHBG025699.
InParanoidiQ86VE9.
OMAiCCPTREF.
OrthoDBiEOG091G06BW.
PhylomeDBiQ86VE9.
TreeFamiTF312881.

Enzyme and pathway databases

ReactomeiR-HSA-977347. Serine biosynthesis.

Miscellaneous databases

ChiTaRSiSERINC5. human.
GenomeRNAii256987.
PROiQ86VE9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164300.
CleanExiHS_SERINC5.
ExpressionAtlasiQ86VE9. baseline and differential.
GenevisibleiQ86VE9. HS.

Family and domain databases

InterProiIPR029555. Serinc5.
IPR005016. TDE1/TMS.
[Graphical view]
PANTHERiPTHR10383. PTHR10383. 1 hit.
PTHR10383:SF16. PTHR10383:SF16. 1 hit.
PfamiPF03348. Serinc. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSERC5_HUMAN
AccessioniPrimary (citable) accession number: Q86VE9
Secondary accession number(s): B4DMH7, Q495A4, Q495A6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: June 1, 2003
Last modified: November 30, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.