Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine incorporator 5

Gene

SERINC5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes (By similarity).By similarity

GO - Molecular functioni

  1. L-serine transmembrane transporter activity Source: InterPro

GO - Biological processi

  1. myelination Source: Ensembl
  2. phosphatidylserine metabolic process Source: HGNC
  3. phospholipid biosynthetic process Source: UniProtKB-KW
  4. positive regulation of transferase activity Source: HGNC
  5. sphingolipid metabolic process Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Names & Taxonomyi

Protein namesi
Recommended name:
Serine incorporator 5
Gene namesi
Name:SERINC5
Synonyms:C5orf12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:18825. SERINC5.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3636ExtracellularSequence AnalysisAdd
BLAST
Transmembranei37 – 5721HelicalSequence AnalysisAdd
BLAST
Topological domaini58 – 8932CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei90 – 11021HelicalSequence AnalysisAdd
BLAST
Topological domaini111 – 12414ExtracellularSequence AnalysisAdd
BLAST
Transmembranei125 – 14521HelicalSequence AnalysisAdd
BLAST
Topological domaini146 – 15611CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei157 – 17721HelicalSequence AnalysisAdd
BLAST
Topological domaini178 – 19821ExtracellularSequence AnalysisAdd
BLAST
Transmembranei199 – 21921HelicalSequence AnalysisAdd
BLAST
Topological domaini220 – 23011CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei231 – 25121HelicalSequence AnalysisAdd
BLAST
Topological domaini252 – 2587ExtracellularSequence Analysis
Transmembranei259 – 27921HelicalSequence AnalysisAdd
BLAST
Topological domaini280 – 31132CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei312 – 33221HelicalSequence AnalysisAdd
BLAST
Topological domaini333 – 38553ExtracellularSequence AnalysisAdd
BLAST
Transmembranei386 – 40621HelicalSequence AnalysisAdd
BLAST
Topological domaini407 – 42317CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  2. extracellular vesicular exosome Source: UniProtKB
  3. Golgi apparatus Source: Ensembl
  4. integral component of membrane Source: UniProtKB-KW
  5. myelin sheath Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38698.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 423423Serine incorporator 5PRO_0000330630Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi113 – 1131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi183 – 1831N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ86VE9.
PaxDbiQ86VE9.
PRIDEiQ86VE9.

PTM databases

PhosphoSiteiQ86VE9.

Expressioni

Tissue specificityi

Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain.1 Publication

Gene expression databases

BgeeiQ86VE9.
CleanExiHS_SERINC5.
ExpressionAtlasiQ86VE9. baseline and differential.
GenevestigatoriQ86VE9.

Organism-specific databases

HPAiHPA037898.
HPA037899.

Interactioni

Protein-protein interaction databases

DIPiDIP-47313N.
IntActiQ86VE9. 1 interaction.
STRINGi9606.ENSP00000406585.

Structurei

3D structure databases

ProteinModelPortaliQ86VE9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 2622Cys-richAdd
BLAST

Sequence similaritiesi

Belongs to the TDE1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG247442.
GeneTreeiENSGT00550000074522.
HOGENOMiHOG000165463.
HOVERGENiHBG025699.
InParanoidiQ86VE9.
OMAiFWVKMAS.
PhylomeDBiQ86VE9.
TreeFamiTF312881.

Family and domain databases

InterProiIPR029555. Serinc5.
IPR005016. TDE1/TMS.
[Graphical view]
PANTHERiPTHR10383. PTHR10383. 1 hit.
PTHR10383:SF16. PTHR10383:SF16. 1 hit.
PfamiPF03348. Serinc. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86VE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAQCCAGQL ACCCGSAGCS LCCDCCPRIR QSLSTRFMYA LYFILVVVLC
60 70 80 90 100
CIMMSTTVAH KMKEHIPFFE DMCKGIKAGD TCEKLVGYSA VYRVCFGMAC
110 120 130 140 150
FFFIFCLLTL KINNSKSCRA HIHNGFWFFK LLLLGAMCSG AFFIPDQDTF
160 170 180 190 200
LNAWRYVGAV GGFLFIGIQL LLLVEFAHKW NKNWTAGTAS NKLWYASLAL
210 220 230 240 250
VTLIMYSIAT GGLVLMAVFY TQKDSCMENK ILLGVNGGLC LLISLVAISP
260 270 280 290 300
WVQNRQPHSG LLQSGVISCY VTYLTFSALS SKPAEVVLDE HGKNVTICVP
310 320 330 340 350
DFGQDLYRDE NLVTILGTSL LIGCILYSCL TSTTRSSSDA LQGRYAAPEL
360 370 380 390 400
EIARCCFCFS PGGEDTEEQQ PGKEGPRVIY DEKKGTVYIY SYFHFVFFLA
410 420
SLYVMMTVTN WFNHVRSAFH LLP
Length:423
Mass (Da):47,009
Last modified:June 1, 2003 - v1
Checksum:iB05A461D418D049B
GO
Isoform 2 (identifier: Q86VE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-416: NHVR → K

Show »
Length:420
Mass (Da):46,631
Checksum:i8ACF67E0D648341F
GO
Isoform 3 (identifier: Q86VE9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-423: NHVRSAFHLLP → KNYQC

Show »
Length:417
Mass (Da):46,373
Checksum:iBF994EA5EFBEEDC7
GO
Isoform 4 (identifier: Q86VE9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV

Show »
Length:461
Mass (Da):51,335
Checksum:i3B74F5AA1944E437
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei413 – 42311NHVRSAFHLLP → KNYQC in isoform 3. 1 PublicationVSP_033054Add
BLAST
Alternative sequencei413 – 4164NHVR → K in isoform 2. 1 PublicationVSP_033055
Alternative sequencei414 – 42310HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4. 1 PublicationVSP_042310

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF498273 mRNA. Translation: AAP06800.1.
AK297467 mRNA. Translation: BAG59889.1.
AC010260 Genomic DNA. No translation available.
AC012636 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95843.1.
CH471084 Genomic DNA. Translation: EAW95844.1.
CH471084 Genomic DNA. Translation: EAW95845.1.
BC101280 mRNA. Translation: AAI01281.1.
BC101281 mRNA. Translation: AAI01282.1.
BC101283 mRNA. Translation: AAI01284.1.
CCDSiCCDS54873.1. [Q86VE9-1]
CCDS54874.1. [Q86VE9-4]
RefSeqiNP_001167542.1. NM_001174071.2. [Q86VE9-2]
NP_001167543.1. NM_001174072.2. [Q86VE9-4]
NP_840060.1. NM_178276.6. [Q86VE9-1]
UniGeneiHs.288232.

Genome annotation databases

EnsembliENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-4]
ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
GeneIDi256987.
KEGGihsa:256987.
UCSCiuc003kgj.3. human. [Q86VE9-1]
uc003kgm.3. human. [Q86VE9-2]
uc011ctj.2. human. [Q86VE9-4]

Polymorphism databases

DMDMi74714045.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF498273 mRNA. Translation: AAP06800.1.
AK297467 mRNA. Translation: BAG59889.1.
AC010260 Genomic DNA. No translation available.
AC012636 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95843.1.
CH471084 Genomic DNA. Translation: EAW95844.1.
CH471084 Genomic DNA. Translation: EAW95845.1.
BC101280 mRNA. Translation: AAI01281.1.
BC101281 mRNA. Translation: AAI01282.1.
BC101283 mRNA. Translation: AAI01284.1.
CCDSiCCDS54873.1. [Q86VE9-1]
CCDS54874.1. [Q86VE9-4]
RefSeqiNP_001167542.1. NM_001174071.2. [Q86VE9-2]
NP_001167543.1. NM_001174072.2. [Q86VE9-4]
NP_840060.1. NM_178276.6. [Q86VE9-1]
UniGeneiHs.288232.

3D structure databases

ProteinModelPortaliQ86VE9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-47313N.
IntActiQ86VE9. 1 interaction.
STRINGi9606.ENSP00000406585.

PTM databases

PhosphoSiteiQ86VE9.

Polymorphism databases

DMDMi74714045.

Proteomic databases

MaxQBiQ86VE9.
PaxDbiQ86VE9.
PRIDEiQ86VE9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-4]
ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
GeneIDi256987.
KEGGihsa:256987.
UCSCiuc003kgj.3. human. [Q86VE9-1]
uc003kgm.3. human. [Q86VE9-2]
uc011ctj.2. human. [Q86VE9-4]

Organism-specific databases

CTDi256987.
GeneCardsiGC05M079407.
HGNCiHGNC:18825. SERINC5.
HPAiHPA037898.
HPA037899.
MIMi614551. gene.
neXtProtiNX_Q86VE9.
PharmGKBiPA38698.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG247442.
GeneTreeiENSGT00550000074522.
HOGENOMiHOG000165463.
HOVERGENiHBG025699.
InParanoidiQ86VE9.
OMAiFWVKMAS.
PhylomeDBiQ86VE9.
TreeFamiTF312881.

Miscellaneous databases

ChiTaRSiSERINC5. human.
GenomeRNAii256987.
NextBioi92895.
PROiQ86VE9.
SOURCEiSearch...

Gene expression databases

BgeeiQ86VE9.
CleanExiHS_SERINC5.
ExpressionAtlasiQ86VE9. baseline and differential.
GenevestigatoriQ86VE9.

Family and domain databases

InterProiIPR029555. Serinc5.
IPR005016. TDE1/TMS.
[Graphical view]
PANTHERiPTHR10383. PTHR10383. 1 hit.
PTHR10383:SF16. PTHR10383:SF16. 1 hit.
PfamiPF03348. Serinc. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of a novel human C5orf12 gene, a member of the TMS_TDE family."
    Xu J., Ji C., Wang L., Cao Y., Dai J., Ye X., Zeng L., Dai J., Wu Q., Xie Y., Mao Y.
    Mol. Biol. Rep. 30:47-52(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Fetus.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).

Entry informationi

Entry nameiSERC5_HUMAN
AccessioniPrimary (citable) accession number: Q86VE9
Secondary accession number(s): B4DMH7, Q495A4, Q495A6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: June 1, 2003
Last modified: March 4, 2015
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.