Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q86VE9 (SERC5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Serine incorporator 5
Gene names
Name:SERINC5
Synonyms:C5orf12
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length423 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes By similarity. Ref.1

Subcellular location

Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain. Ref.1

Sequence similarities

Belongs to the TDE1 family.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q86VE9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q86VE9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     413-416: NHVR → K
Isoform 3 (identifier: Q86VE9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     413-423: NHVRSAFHLLP → KNYQC
Isoform 4 (identifier: Q86VE9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 423423Serine incorporator 5
PRO_0000330630

Regions

Topological domain1 – 3636Extracellular Potential
Transmembrane37 – 5721Helical; Potential
Topological domain58 – 8932Cytoplasmic Potential
Transmembrane90 – 11021Helical; Potential
Topological domain111 – 12414Extracellular Potential
Transmembrane125 – 14521Helical; Potential
Topological domain146 – 15611Cytoplasmic Potential
Transmembrane157 – 17721Helical; Potential
Topological domain178 – 19821Extracellular Potential
Transmembrane199 – 21921Helical; Potential
Topological domain220 – 23011Cytoplasmic Potential
Transmembrane231 – 25121Helical; Potential
Topological domain252 – 2587Extracellular Potential
Transmembrane259 – 27921Helical; Potential
Topological domain280 – 31132Cytoplasmic Potential
Transmembrane312 – 33221Helical; Potential
Topological domain333 – 38553Extracellular Potential
Transmembrane386 – 40621Helical; Potential
Topological domain407 – 42317Cytoplasmic Potential
Compositional bias5 – 2622Cys-rich

Amino acid modifications

Glycosylation1131N-linked (GlcNAc...) Potential
Glycosylation1831N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence413 – 42311NHVRSAFHLLP → KNYQC in isoform 3.
VSP_033054
Alternative sequence413 – 4164NHVR → K in isoform 2.
VSP_033055
Alternative sequence414 – 42310HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4.
VSP_042310

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2003. Version 1.
Checksum: B05A461D418D049B

FASTA42347,009
        10         20         30         40         50         60 
MSAQCCAGQL ACCCGSAGCS LCCDCCPRIR QSLSTRFMYA LYFILVVVLC CIMMSTTVAH 

        70         80         90        100        110        120 
KMKEHIPFFE DMCKGIKAGD TCEKLVGYSA VYRVCFGMAC FFFIFCLLTL KINNSKSCRA 

       130        140        150        160        170        180 
HIHNGFWFFK LLLLGAMCSG AFFIPDQDTF LNAWRYVGAV GGFLFIGIQL LLLVEFAHKW 

       190        200        210        220        230        240 
NKNWTAGTAS NKLWYASLAL VTLIMYSIAT GGLVLMAVFY TQKDSCMENK ILLGVNGGLC 

       250        260        270        280        290        300 
LLISLVAISP WVQNRQPHSG LLQSGVISCY VTYLTFSALS SKPAEVVLDE HGKNVTICVP 

       310        320        330        340        350        360 
DFGQDLYRDE NLVTILGTSL LIGCILYSCL TSTTRSSSDA LQGRYAAPEL EIARCCFCFS 

       370        380        390        400        410        420 
PGGEDTEEQQ PGKEGPRVIY DEKKGTVYIY SYFHFVFFLA SLYVMMTVTN WFNHVRSAFH 


LLP 

« Hide

Isoform 2 [UniParc].

Checksum: 8ACF67E0D648341F
Show »

FASTA42046,631
Isoform 3 [UniParc].

Checksum: BF994EA5EFBEEDC7
Show »

FASTA41746,373
Isoform 4 [UniParc].

Checksum: 3B74F5AA1944E437
Show »

FASTA46151,335

References

« Hide 'large scale' references
[1]"Cloning and expression of a novel human C5orf12 gene, a member of the TMS_TDE family."
Xu J., Ji C., Wang L., Cao Y., Dai J., Ye X., Zeng L., Dai J., Wu Q., Xie Y., Mao Y.
Mol. Biol. Rep. 30:47-52(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
Tissue: Fetus.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Brain.
[3]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF498273 mRNA. Translation: AAP06800.1.
AK297467 mRNA. Translation: BAG59889.1.
AC010260 Genomic DNA. No translation available.
AC012636 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95843.1.
CH471084 Genomic DNA. Translation: EAW95844.1.
CH471084 Genomic DNA. Translation: EAW95845.1.
BC101280 mRNA. Translation: AAI01281.1.
BC101281 mRNA. Translation: AAI01282.1.
BC101283 mRNA. Translation: AAI01284.1.
RefSeqNP_001167542.1. NM_001174071.1.
NP_001167543.1. NM_001174072.1.
NP_840060.1. NM_178276.5.
UniGeneHs.288232.

3D structure databases

ProteinModelPortalQ86VE9.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-47313N.
STRING9606.ENSP00000406585.

PTM databases

PhosphoSiteQ86VE9.

Polymorphism databases

DMDM74714045.

Proteomic databases

PaxDbQ86VE9.
PRIDEQ86VE9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-1]
ENST00000512721; ENSP00000420863; ENSG00000164300. [Q86VE9-4]
ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
GeneID256987.
KEGGhsa:256987.
UCSCuc003kgj.3. human. [Q86VE9-1]
uc003kgm.3. human. [Q86VE9-2]
uc011ctj.2. human. [Q86VE9-4]

Organism-specific databases

CTD256987.
GeneCardsGC05M079407.
HGNCHGNC:18825. SERINC5.
HPAHPA037898.
MIM614551. gene.
neXtProtNX_Q86VE9.
PharmGKBPA38698.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG247442.
HOGENOMHOG000165463.
HOVERGENHBG025699.
InParanoidQ86VE9.
OMAFWVKMAS.
PhylomeDBQ86VE9.
TreeFamTF312881.

Gene expression databases

ArrayExpressQ86VE9.
BgeeQ86VE9.
CleanExHS_SERINC5.
GenevestigatorQ86VE9.

Family and domain databases

InterProIPR005016. TMS_TDE.
[Graphical view]
PANTHERPTHR10383. PTHR10383. 1 hit.
PfamPF03348. Serinc. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSERINC5. human.
GenomeRNAi256987.
NextBio92895.
PROQ86VE9.
SOURCESearch...

Entry information

Entry nameSERC5_HUMAN
AccessionPrimary (citable) accession number: Q86VE9
Secondary accession number(s): B4DMH7, Q495A4, Q495A6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: June 1, 2003
Last modified: April 16, 2014
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM