Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine incorporator 5

Gene

SERINC5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm (PubMed:26416733, PubMed:26416734). Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes (By similarity).By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAntiviral defense, Host-virus interaction, Immunity, Innate immunity, Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Enzyme and pathway databases

ReactomeiR-HSA-977347 Serine biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Serine incorporator 5Curated
Gene namesi
Name:SERINC5Imported
Synonyms:C5orf12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000164300.15
HGNCiHGNC:18825 SERINC5
MIMi614551 gene
neXtProtiNX_Q86VE9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 36ExtracellularSequence analysisAdd BLAST36
Transmembranei37 – 57HelicalSequence analysisAdd BLAST21
Topological domaini58 – 89CytoplasmicSequence analysisAdd BLAST32
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Topological domaini111 – 124ExtracellularSequence analysisAdd BLAST14
Transmembranei125 – 145HelicalSequence analysisAdd BLAST21
Topological domaini146 – 156CytoplasmicSequence analysisAdd BLAST11
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Topological domaini178 – 198ExtracellularSequence analysisAdd BLAST21
Transmembranei199 – 219HelicalSequence analysisAdd BLAST21
Topological domaini220 – 230CytoplasmicSequence analysisAdd BLAST11
Transmembranei231 – 251HelicalSequence analysisAdd BLAST21
Topological domaini252 – 258ExtracellularSequence analysis7
Transmembranei259 – 279HelicalSequence analysisAdd BLAST21
Topological domaini280 – 311CytoplasmicSequence analysisAdd BLAST32
Transmembranei312 – 332HelicalSequence analysisAdd BLAST21
Topological domaini333 – 385ExtracellularSequence analysisAdd BLAST53
Transmembranei386 – 406HelicalSequence analysisAdd BLAST21
Topological domaini407 – 423CytoplasmicSequence analysisAdd BLAST17

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi256987
OpenTargetsiENSG00000164300
PharmGKBiPA38698

Polymorphism and mutation databases

BioMutaiSERINC5
DMDMi74714045

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003306301 – 423Serine incorporator 5Add BLAST423

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi113N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi183N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ86VE9
PaxDbiQ86VE9
PeptideAtlasiQ86VE9
PRIDEiQ86VE9

PTM databases

iPTMnetiQ86VE9
PhosphoSitePlusiQ86VE9

Expressioni

Tissue specificityi

Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain.1 Publication

Gene expression databases

BgeeiENSG00000164300
CleanExiHS_SERINC5
ExpressionAtlasiQ86VE9 baseline and differential
GenevisibleiQ86VE9 HS

Organism-specific databases

HPAiHPA037898
HPA037899

Interactioni

Protein-protein interaction databases

BioGridi129188, 1 interactor
DIPiDIP-47313N
IntActiQ86VE9, 1 interactor
STRINGi9606.ENSP00000420863

Structurei

3D structure databases

ProteinModelPortaliQ86VE9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 26Cys-richAdd BLAST22

Sequence similaritiesi

Belongs to the TDE1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2592 Eukaryota
ENOG410XP7K LUCA
GeneTreeiENSGT00550000074522
HOGENOMiHOG000165463
HOVERGENiHBG025699
InParanoidiQ86VE9
OMAiTVTNWFN
OrthoDBiEOG091G06BW
PhylomeDBiQ86VE9
TreeFamiTF312881

Family and domain databases

InterProiView protein in InterPro
IPR029555 Serinc5
IPR005016 TDE1/TMS
PANTHERiPTHR10383 PTHR10383, 1 hit
PTHR10383:SF16 PTHR10383:SF16, 1 hit
PfamiView protein in Pfam
PF03348 Serinc, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86VE9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAQCCAGQL ACCCGSAGCS LCCDCCPRIR QSLSTRFMYA LYFILVVVLC
60 70 80 90 100
CIMMSTTVAH KMKEHIPFFE DMCKGIKAGD TCEKLVGYSA VYRVCFGMAC
110 120 130 140 150
FFFIFCLLTL KINNSKSCRA HIHNGFWFFK LLLLGAMCSG AFFIPDQDTF
160 170 180 190 200
LNAWRYVGAV GGFLFIGIQL LLLVEFAHKW NKNWTAGTAS NKLWYASLAL
210 220 230 240 250
VTLIMYSIAT GGLVLMAVFY TQKDSCMENK ILLGVNGGLC LLISLVAISP
260 270 280 290 300
WVQNRQPHSG LLQSGVISCY VTYLTFSALS SKPAEVVLDE HGKNVTICVP
310 320 330 340 350
DFGQDLYRDE NLVTILGTSL LIGCILYSCL TSTTRSSSDA LQGRYAAPEL
360 370 380 390 400
EIARCCFCFS PGGEDTEEQQ PGKEGPRVIY DEKKGTVYIY SYFHFVFFLA
410 420
SLYVMMTVTN WFNHVRSAFH LLP
Length:423
Mass (Da):47,009
Last modified:June 1, 2003 - v1
Checksum:iB05A461D418D049B
GO
Isoform 2 (identifier: Q86VE9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-416: NHVR → K

Show »
Length:420
Mass (Da):46,631
Checksum:i8ACF67E0D648341F
GO
Isoform 3 (identifier: Q86VE9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-423: NHVRSAFHLLP → KNYQC

Show »
Length:417
Mass (Da):46,373
Checksum:iBF994EA5EFBEEDC7
GO
Isoform 4 (identifier: Q86VE9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV

Show »
Length:461
Mass (Da):51,335
Checksum:i3B74F5AA1944E437
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033054413 – 423NHVRSAFHLLP → KNYQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033055413 – 416NHVR → K in isoform 2. 1 Publication4
Alternative sequenceiVSP_042310414 – 423HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4. 1 Publication10

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF498273 mRNA Translation: AAP06800.1
AK297467 mRNA Translation: BAG59889.1
AC010260 Genomic DNA No translation available.
AC012636 Genomic DNA No translation available.
CH471084 Genomic DNA Translation: EAW95843.1
CH471084 Genomic DNA Translation: EAW95844.1
CH471084 Genomic DNA Translation: EAW95845.1
BC101280 mRNA Translation: AAI01281.1
BC101281 mRNA Translation: AAI01282.1
BC101283 mRNA Translation: AAI01284.1
CCDSiCCDS54874.1 [Q86VE9-4]
CCDS83009.1 [Q86VE9-2]
RefSeqiNP_001167542.1, NM_001174071.2 [Q86VE9-2]
NP_001167543.1, NM_001174072.2 [Q86VE9-4]
NP_840060.1, NM_178276.6 [Q86VE9-1]
UniGeneiHs.288232

Genome annotation databases

EnsembliENST00000507668; ENSP00000426237; ENSG00000164300 [Q86VE9-4]
ENST00000509193; ENSP00000426134; ENSG00000164300 [Q86VE9-2]
ENST00000512972; ENSP00000421665; ENSG00000164300 [Q86VE9-3]
GeneIDi256987
KEGGihsa:256987
UCSCiuc011ctj.2 human [Q86VE9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSERC5_HUMAN
AccessioniPrimary (citable) accession number: Q86VE9
Secondary accession number(s): B4DMH7, Q495A4, Q495A6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: June 1, 2003
Last modified: March 28, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health