Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86VE9

- SERC5_HUMAN

UniProt

Q86VE9 - SERC5_HUMAN

Protein

Serine incorporator 5

Gene

SERINC5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (01 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes By similarity.By similarity

    GO - Biological processi

    1. myelination Source: Ensembl
    2. phosphatidylserine metabolic process Source: HGNC
    3. phospholipid biosynthetic process Source: UniProtKB-KW
    4. positive regulation of transferase activity Source: HGNC

    Keywords - Biological processi

    Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine incorporator 5
    Gene namesi
    Name:SERINC5
    Synonyms:C5orf12
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:18825. SERINC5.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. extracellular vesicular exosome Source: UniProt
    3. Golgi apparatus Source: Ensembl
    4. integral component of membrane Source: UniProtKB-KW
    5. myelin sheath Source: Ensembl

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38698.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 423423Serine incorporator 5PRO_0000330630Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi113 – 1131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi183 – 1831N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ86VE9.
    PaxDbiQ86VE9.
    PRIDEiQ86VE9.

    PTM databases

    PhosphoSiteiQ86VE9.

    Expressioni

    Tissue specificityi

    Highly expressed in placenta, skeletal muscle, spleen, thymus, testis and peripheral leukocyte and is expressed weakly in the heart, liver and fetal brain.1 Publication

    Gene expression databases

    ArrayExpressiQ86VE9.
    BgeeiQ86VE9.
    CleanExiHS_SERINC5.
    GenevestigatoriQ86VE9.

    Organism-specific databases

    HPAiHPA037898.

    Interactioni

    Protein-protein interaction databases

    DIPiDIP-47313N.
    IntActiQ86VE9. 1 interaction.
    STRINGi9606.ENSP00000406585.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86VE9.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3636ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini58 – 8932CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini111 – 12414ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini146 – 15611CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini178 – 19821ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini220 – 23011CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini252 – 2587ExtracellularSequence Analysis
    Topological domaini280 – 31132CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini333 – 38553ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini407 – 42317CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei37 – 5721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei90 – 11021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei125 – 14521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei157 – 17721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei199 – 21921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei231 – 25121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei259 – 27921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei312 – 33221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei386 – 40621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi5 – 2622Cys-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TDE1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG247442.
    HOGENOMiHOG000165463.
    HOVERGENiHBG025699.
    InParanoidiQ86VE9.
    OMAiFWVKMAS.
    PhylomeDBiQ86VE9.
    TreeFamiTF312881.

    Family and domain databases

    InterProiIPR029555. Serinc5.
    IPR005016. TDE1/TMS.
    [Graphical view]
    PANTHERiPTHR10383. PTHR10383. 1 hit.
    PTHR10383:SF16. PTHR10383:SF16. 1 hit.
    PfamiPF03348. Serinc. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86VE9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAQCCAGQL ACCCGSAGCS LCCDCCPRIR QSLSTRFMYA LYFILVVVLC    50
    CIMMSTTVAH KMKEHIPFFE DMCKGIKAGD TCEKLVGYSA VYRVCFGMAC 100
    FFFIFCLLTL KINNSKSCRA HIHNGFWFFK LLLLGAMCSG AFFIPDQDTF 150
    LNAWRYVGAV GGFLFIGIQL LLLVEFAHKW NKNWTAGTAS NKLWYASLAL 200
    VTLIMYSIAT GGLVLMAVFY TQKDSCMENK ILLGVNGGLC LLISLVAISP 250
    WVQNRQPHSG LLQSGVISCY VTYLTFSALS SKPAEVVLDE HGKNVTICVP 300
    DFGQDLYRDE NLVTILGTSL LIGCILYSCL TSTTRSSSDA LQGRYAAPEL 350
    EIARCCFCFS PGGEDTEEQQ PGKEGPRVIY DEKKGTVYIY SYFHFVFFLA 400
    SLYVMMTVTN WFNHVRSAFH LLP 423
    Length:423
    Mass (Da):47,009
    Last modified:June 1, 2003 - v1
    Checksum:iB05A461D418D049B
    GO
    Isoform 2 (identifier: Q86VE9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         413-416: NHVR → K

    Show »
    Length:420
    Mass (Da):46,631
    Checksum:i8ACF67E0D648341F
    GO
    Isoform 3 (identifier: Q86VE9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         413-423: NHVRSAFHLLP → KNYQC

    Show »
    Length:417
    Mass (Da):46,373
    Checksum:iBF994EA5EFBEEDC7
    GO
    Isoform 4 (identifier: Q86VE9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         414-423: HVRSAFHLLP → YESANIESFFSGSWSIFWVKMASCWICVLLYLCTLVAPLCCPTREFSV

    Show »
    Length:461
    Mass (Da):51,335
    Checksum:i3B74F5AA1944E437
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei413 – 42311NHVRSAFHLLP → KNYQC in isoform 3. 1 PublicationVSP_033054Add
    BLAST
    Alternative sequencei413 – 4164NHVR → K in isoform 2. 1 PublicationVSP_033055
    Alternative sequencei414 – 42310HVRSAFHLLP → YESANIESFFSGSWSIFWVK MASCWICVLLYLCTLVAPLC CPTREFSV in isoform 4. 1 PublicationVSP_042310

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF498273 mRNA. Translation: AAP06800.1.
    AK297467 mRNA. Translation: BAG59889.1.
    AC010260 Genomic DNA. No translation available.
    AC012636 Genomic DNA. No translation available.
    CH471084 Genomic DNA. Translation: EAW95843.1.
    CH471084 Genomic DNA. Translation: EAW95844.1.
    CH471084 Genomic DNA. Translation: EAW95845.1.
    BC101280 mRNA. Translation: AAI01281.1.
    BC101281 mRNA. Translation: AAI01282.1.
    BC101283 mRNA. Translation: AAI01284.1.
    CCDSiCCDS54873.1. [Q86VE9-1]
    CCDS54874.1. [Q86VE9-4]
    RefSeqiNP_001167542.1. NM_001174071.1. [Q86VE9-2]
    NP_001167543.1. NM_001174072.1. [Q86VE9-4]
    NP_840060.1. NM_178276.5. [Q86VE9-1]
    UniGeneiHs.288232.

    Genome annotation databases

    EnsembliENST00000507668; ENSP00000426237; ENSG00000164300. [Q86VE9-1]
    ENST00000512721; ENSP00000420863; ENSG00000164300. [Q86VE9-4]
    ENST00000512972; ENSP00000421665; ENSG00000164300. [Q86VE9-3]
    GeneIDi256987.
    KEGGihsa:256987.
    UCSCiuc003kgj.3. human. [Q86VE9-1]
    uc003kgm.3. human. [Q86VE9-2]
    uc011ctj.2. human. [Q86VE9-4]

    Polymorphism databases

    DMDMi74714045.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF498273 mRNA. Translation: AAP06800.1 .
    AK297467 mRNA. Translation: BAG59889.1 .
    AC010260 Genomic DNA. No translation available.
    AC012636 Genomic DNA. No translation available.
    CH471084 Genomic DNA. Translation: EAW95843.1 .
    CH471084 Genomic DNA. Translation: EAW95844.1 .
    CH471084 Genomic DNA. Translation: EAW95845.1 .
    BC101280 mRNA. Translation: AAI01281.1 .
    BC101281 mRNA. Translation: AAI01282.1 .
    BC101283 mRNA. Translation: AAI01284.1 .
    CCDSi CCDS54873.1. [Q86VE9-1 ]
    CCDS54874.1. [Q86VE9-4 ]
    RefSeqi NP_001167542.1. NM_001174071.1. [Q86VE9-2 ]
    NP_001167543.1. NM_001174072.1. [Q86VE9-4 ]
    NP_840060.1. NM_178276.5. [Q86VE9-1 ]
    UniGenei Hs.288232.

    3D structure databases

    ProteinModelPortali Q86VE9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-47313N.
    IntActi Q86VE9. 1 interaction.
    STRINGi 9606.ENSP00000406585.

    PTM databases

    PhosphoSitei Q86VE9.

    Polymorphism databases

    DMDMi 74714045.

    Proteomic databases

    MaxQBi Q86VE9.
    PaxDbi Q86VE9.
    PRIDEi Q86VE9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000507668 ; ENSP00000426237 ; ENSG00000164300 . [Q86VE9-1 ]
    ENST00000512721 ; ENSP00000420863 ; ENSG00000164300 . [Q86VE9-4 ]
    ENST00000512972 ; ENSP00000421665 ; ENSG00000164300 . [Q86VE9-3 ]
    GeneIDi 256987.
    KEGGi hsa:256987.
    UCSCi uc003kgj.3. human. [Q86VE9-1 ]
    uc003kgm.3. human. [Q86VE9-2 ]
    uc011ctj.2. human. [Q86VE9-4 ]

    Organism-specific databases

    CTDi 256987.
    GeneCardsi GC05M079407.
    HGNCi HGNC:18825. SERINC5.
    HPAi HPA037898.
    MIMi 614551. gene.
    neXtProti NX_Q86VE9.
    PharmGKBi PA38698.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG247442.
    HOGENOMi HOG000165463.
    HOVERGENi HBG025699.
    InParanoidi Q86VE9.
    OMAi FWVKMAS.
    PhylomeDBi Q86VE9.
    TreeFami TF312881.

    Miscellaneous databases

    ChiTaRSi SERINC5. human.
    GenomeRNAii 256987.
    NextBioi 92895.
    PROi Q86VE9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q86VE9.
    Bgeei Q86VE9.
    CleanExi HS_SERINC5.
    Genevestigatori Q86VE9.

    Family and domain databases

    InterProi IPR029555. Serinc5.
    IPR005016. TDE1/TMS.
    [Graphical view ]
    PANTHERi PTHR10383. PTHR10383. 1 hit.
    PTHR10383:SF16. PTHR10383:SF16. 1 hit.
    Pfami PF03348. Serinc. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of a novel human C5orf12 gene, a member of the TMS_TDE family."
      Xu J., Ji C., Wang L., Cao Y., Dai J., Ye X., Zeng L., Dai J., Wu Q., Xie Y., Mao Y.
      Mol. Biol. Rep. 30:47-52(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Fetus.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    3. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).

    Entry informationi

    Entry nameiSERC5_HUMAN
    AccessioniPrimary (citable) accession number: Q86VE9
    Secondary accession number(s): B4DMH7, Q495A4, Q495A6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: June 1, 2003
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3