Q86VB7 (C163A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Scavenger receptor cysteine-rich type 1 protein M130 Alternative name(s): Hemoglobin scavenger receptor CD_antigen=CD163 Cleaved into the following chain:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1156 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells. Ref.7 Ref.9 Ref.10 Ref.12 Ref.18 After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions. Ref.7 Ref.9 Ref.10 Ref.12 Ref.18 |
| Subunit structure | Interacts with CSNK2B. Ref.9 |
| Subcellular location | Soluble CD163: Secreted Ref.7 Ref.8. Cell membrane; Single-pass type I membrane protein. Note: Isoform 1 and isoform 2 show a lower surface expression when expressed in cells. Ref.7 Ref.8 |
| Tissue specificity | Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood. Ref.7 Ref.10 Ref.18 |
| Induction | Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF. Ref.7 Ref.8 |
| Domain | The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes. Ref.15 |
| Post-translational modification | A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs. Phosphorylated Probable. Ref.9 |
| Miscellaneous | Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes. The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer. |
| Sequence similarities | Contains 9 SRCR domains. |
| Caution | It is uncertain whether Met-1 or Met-6 is the initiator. |
| Biophysicochemical properties | Kinetic parameters: KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype Ref.10 KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype |
| Sequence caution | The sequence CAA80541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA80542.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA80543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA80544.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAB45233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Acute phase Inflammatory response |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | acute-phase response Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | extracellular region Non-traceable author statement. Source: UniProtKB integral to plasma membraneTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | scavenger receptor activity Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86VB7-1) Also known as: Long tail variant 1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86VB7-2) Also known as: Long tail variant 2; The sequence of this isoform differs from the canonical sequence as follows: 1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE | ||||||
| Isoform 3 (identifier: Q86VB7-3) Also known as: Short tail variant; The sequence of this isoform differs from the canonical sequence as follows: 1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH | ||||||
| Isoform 4 (identifier: Q86VB7-4) The sequence of this isoform differs from the canonical sequence as follows: 579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG 1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 41 | 41 | Potential | ||||||||
| Chain | 42 – 1156 | 1115 | Scavenger receptor cysteine-rich type 1 protein M130 | PRO_0000238938 | |||||||
| Chain | 42 – ? | Soluble CD163 | PRO_0000238939 | ||||||||
Regions | |||||||||||
| Topological domain | 42 – 1050 | 1009 | Extracellular Potential | ||||||||
| Transmembrane | 1051 – 1071 | 21 | Helical; Potential | ||||||||
| Topological domain | 1072 – 1156 | 85 | Cytoplasmic Potential | ||||||||
| Domain | 51 – 152 | 102 | SRCR 1 | ||||||||
| Domain | 159 – 259 | 101 | SRCR 2 | ||||||||
| Domain | 266 – 366 | 101 | SRCR 3 | ||||||||
| Domain | 373 – 473 | 101 | SRCR 4 | ||||||||
| Domain | 478 – 578 | 101 | SRCR 5 | ||||||||
| Domain | 583 – 683 | 101 | SRCR 6 | ||||||||
| Domain | 719 – 819 | 101 | SRCR 7 | ||||||||
| Domain | 824 – 926 | 103 | SRCR 8 | ||||||||
| Domain | 929 – 1029 | 101 | SRCR 9 | ||||||||
| Motif | 1096 – 1099 | 4 | Internalization signal | ||||||||
Sites | |||||||||||
| Site | 269 – 270 | 2 | Cleavage; in calcium-free condition | ||||||||
| Site | 281 – 282 | 2 | Cleavage; in calcium-free condition | ||||||||
| Site | 333 – 334 | 2 | Cleavage; in calcium-free condition | ||||||||
| Site | 360 – 361 | 2 | Cleavage; in calcium-free condition | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 14 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 105 | 1 | N-linked (GlcNAc...) Ref.17 Ref.19 | ||||||||
| Glycosylation | 140 | 1 | N-linked (GlcNAc...) Ref.19 | ||||||||
| Glycosylation | 767 | 1 | N-linked (GlcNAc...) Ref.19 | ||||||||
| Glycosylation | 1027 | 1 | N-linked (GlcNAc...) Ref.19 | ||||||||
| Disulfide bond | 76 ↔ 141 | By similarity | |||||||||
| Disulfide bond | 89 ↔ 151 | By similarity | |||||||||
| Disulfide bond | 120 ↔ 130 | By similarity | |||||||||
| Disulfide bond | 184 ↔ 248 | By similarity | |||||||||
| Disulfide bond | 197 ↔ 258 | By similarity | |||||||||
| Disulfide bond | 228 ↔ 238 | By similarity | |||||||||
| Disulfide bond | 291 ↔ 355 | By similarity | |||||||||
| Disulfide bond | 304 ↔ 365 | By similarity | |||||||||
| Disulfide bond | 335 ↔ 345 | By similarity | |||||||||
| Disulfide bond | 398 ↔ 462 | By similarity | |||||||||
| Disulfide bond | 411 ↔ 472 | By similarity | |||||||||
| Disulfide bond | 442 ↔ 452 | By similarity | |||||||||
| Disulfide bond | 503 ↔ 567 | By similarity | |||||||||
| Disulfide bond | 516 ↔ 577 | By similarity | |||||||||
| Disulfide bond | 547 ↔ 557 | By similarity | |||||||||
| Disulfide bond | 608 ↔ 672 | By similarity | |||||||||
| Disulfide bond | 621 ↔ 682 | By similarity | |||||||||
| Disulfide bond | 652 ↔ 662 | By similarity | |||||||||
| Disulfide bond | 744 ↔ 808 | By similarity | |||||||||
| Disulfide bond | 757 ↔ 818 | By similarity | |||||||||
| Disulfide bond | 788 ↔ 798 | By similarity | |||||||||
| Disulfide bond | 864 ↔ 925 | By similarity | |||||||||
| Disulfide bond | 895 ↔ 905 | By similarity | |||||||||
| Disulfide bond | 954 ↔ 1018 | By similarity | |||||||||
| Disulfide bond | 967 ↔ 1028 | By similarity | |||||||||
| Disulfide bond | 998 ↔ 1008 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 579 | 1 | R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. | VSP_019013 | |||||||
| Alternative sequence | 1115 – 1156 | 42 | ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. | VSP_019014 | |||||||
| Alternative sequence | 1115 – 1156 | 42 | ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. | VSP_019015 | |||||||
| Natural variant | 342 | 1 | I → V. Ref.1 Ref.2 Ref.3 Ref.5 Corresponds to variant rs4883263 [ dbSNP | Ensembl ]. | VAR_026574 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 1072 | 1 | T → A: Impaired phosphorylation by PRKCA. Ref.9 | ||||||||
| Mutagenesis | 1084 | 1 | S → A: Impaired phosphorylation by PRKCA. Ref.9 | ||||||||
| Mutagenesis | 1096 | 1 | Y → A: Massive decrease of endocytotic activity. Ref.18 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily." Law S.K.A., Micklem K.J., Shaw J.M., Zhang X.-P., Dong Y., Willis A.C., Mason D.Y. Eur. J. Immunol. 23:2320-2325(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT VAL-342. |
| [2] | "Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily." Ritter M., Buechler C., Langmann T., Schmitz G. Biochem. Biophys. Res. Commun. 260:466-474(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-342. |
| [3] | "Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses." Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L. Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT VAL-342. |
| [4] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-342. Tissue: Spleen. |
| [6] | "Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family." Droste A., Sorg C., Hogger P. Biochem. Biophys. Res. Commun. 256:110-113(1999) [PubMed] [Europe PMC] [Abstract] Cited for: CLEAVAGE. |
| [7] | "Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation." Van den Heuvel M.M., Tensen C.P., van As J.H., Van den Berg T.K., Fluitsma D.M., Dijkstra C.D., Dopp E.A., Droste A., Van Gaalen F.A., Sorg C., Hoegger P., Beelen R.H.J. J. Leukoc. Biol. 66:858-866(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION. |
| [8] | "Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli." Buechler C., Ritter M., Orso E., Langmann T., Klucken J., Schmitz G. J. Leukoc. Biol. 67:97-103(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION, SUBCELLULAR LOCATION. |
| [9] | "Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C." Ritter M., Buechler C., Kapinsky M., Schmitz G. Eur. J. Immunol. 31:999-1009(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF THR-1072 AND SER-1084, INTERACTION WITH CSNK2B. |
| [10] | "Identification of the haemoglobin scavenger receptor." Kristiansen M., Graversen J.H., Jacobsen C., Sonne O., Hoffman H.-J., Law S.K.A., Moestrup S.K. Nature 409:198-201(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, MASS SPECTROMETRY. |
| [11] | "Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3." Matsushita N., Kashiwagi M., Wait R., Nagayoshi R., Nakamura M., Matsuda T., Hogger P., Guyre P.M., Nagase H., Matsuyama T. Clin. Exp. Immunol. 130:156-161(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CLEAVAGE. |
| [12] | "Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect." Frings W., Dreier J., Sorg C. FEBS Lett. 526:93-96(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163." Hintz K.A., Rassias A.J., Wardwell K., Moss M.L., Morganelli P.M., Pioli P.A., Givan A.L., Wallace P.K., Yeager M.P., Guyre P.M. J. Leukoc. Biol. 72:711-717(2002) [PubMed] [Europe PMC] [Abstract] Cited for: MISCELLANEOUS. |
| [14] | "CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response." Moestrup S.K., Moller H.J. Ann. Med. 36:347-354(2004) [PubMed] [Europe PMC] [Abstract] Cited for: RELEVANCE AS DISEASE MARKER IN INFLAMMATORY CONDITIONS. |
| [15] | "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region." Madsen M., Moller H.J., Nielsen M.J., Jacobsen C., Graversen J.H., van den Berg T., Moestrup S.K. J. Biol. Chem. 279:51561-51567(2004) [PubMed] [Europe PMC] [Abstract] Cited for: DOMAIN, CLEAVAGE SITES. |
| [16] | "Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163." Sulahian T.H., Pioli P.A., Wardwell K., Guyre P.M. J. Leukoc. Biol. 76:271-277(2004) [PubMed] [Europe PMC] [Abstract] Cited for: CLEAVAGE. |
| [17] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105, MASS SPECTROMETRY. Tissue: Plasma. |
| [18] | "The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants." Nielsen M.J., Madsen M., Moller H.J., Moestrup S.K. J. Leukoc. Biol. 79:837-845(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF TYR-1096, TISSUE SPECIFICITY. |
| [19] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105; ASN-140; ASN-767 AND ASN-1027, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z22968 mRNA. Translation: CAA80541.1. Different initiation. Z22969 mRNA. Translation: CAA80542.1. Different initiation. Z22970 mRNA. Translation: CAA80543.1. Different initiation. Z22971 mRNA. Translation: CAA80544.1. Different initiation. Y18388 Y18403 Genomic DNA. Translation: CAB45233.1. Different initiation.DQ058615 mRNA. Translation: AAY99762.1. AC131206 Genomic DNA. No translation available. BC051281 mRNA. Translation: AAH51281.1. |
| IPI | IPI00104074. IPI00513892. IPI00759642. IPI00953368. |
| PIR | I38004. I38005. I38006. |
| RefSeq | NP_004235.4. NM_004244.5. NP_981961.2. NM_203416.3. |
| UniGene | Hs.504641. |
3D structure databases | |
| ProteinModelPortal | Q86VB7. |
| SMR | Q86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86VB7. 1 interaction. |
| STRING | 9606.ENSP00000352071. |
PTM databases | |
| PhosphoSite | Q86VB7. |
Proteomic databases | |
| PaxDb | Q86VB7. |
| PRIDE | Q86VB7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359156; ENSP00000352071; ENSG00000177575. ENST00000432237; ENSP00000403885; ENSG00000177575. |
| GeneID | 9332. |
| KEGG | hsa:9332. |
| UCSC | uc001qsz.3. human. uc001qta.3. human. |
Organism-specific databases | |
| CTD | 9332. |
| GeneCards | GC12M007623. |
| HGNC | HGNC:1631. CD163. |
| HPA | CAB002432. |
| MIM | 605545. gene. |
| neXtProt | NX_Q86VB7. |
| PharmGKB | PA26190. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG83796. |
| HOVERGEN | HBG080943. |
| InParanoid | Q86VB7. |
| KO | K06545. |
| OMA | RFQGEWG. |
| OrthoDB | EOG4JWVD4. |
| PhylomeDB | Q86VB7. |
Gene expression databases | |
| ArrayExpress | Q86VB7. |
| Bgee | Q86VB7. |
| CleanEx | HS_CD163. |
| Genevestigator | Q86VB7. |
| GermOnline | ENSG00000177575. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF00530. SRCR. 9 hits. [Graphical view] |
| PRINTS | PR00258. SPERACTRCPTR. |
| SMART | SM00202. SR. 9 hits. [Graphical view] |
| SUPFAM | SSF56487. Srcr_receptor. 9 hits. |
| PROSITE | PS00420. SRCR_1. 4 hits. PS50287. SRCR_2. 9 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CD163. human. |
| GenomeRNAi | 9332. |
| NextBio | 34955. |
| SOURCE | Search... |
Entry information
| Entry name | C163A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86VB7 Secondary accession number(s): C9JIG2 Q2VLH7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
