Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86VB7

- C163A_HUMAN

UniProt

Q86VB7 - C163A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.
After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

Kineticsi

  1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
  2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei269 – 2702Cleavage; in calcium-free condition
Sitei281 – 2822Cleavage; in calcium-free condition
Sitei333 – 3342Cleavage; in calcium-free condition
Sitei360 – 3612Cleavage; in calcium-free condition

GO - Molecular functioni

  1. scavenger receptor activity Source: UniProtKB

GO - Biological processi

  1. acute-phase response Source: UniProtKB-KW
  2. receptor-mediated endocytosis Source: GOC
Complete GO annotation...

Keywords - Biological processi

Acute phase, Inflammatory response

Enzyme and pathway databases

ReactomeiREACT_160163. Scavenging of heme from plasma.

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
Hemoglobin scavenger receptor
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
Gene namesi
Name:CD163
Synonyms:M130
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:1631. CD163.

Subcellular locationi

Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications
Note: Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.

GO - Cellular componenti

  1. endocytic vesicle membrane Source: Reactome
  2. extracellular region Source: UniProtKB-KW
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1072 – 10721T → A: Impaired phosphorylation by PRKCA. 1 Publication
Mutagenesisi1084 – 10841S → A: Impaired phosphorylation by PRKCA. 1 Publication
Mutagenesisi1096 – 10961Y → A: Massive decrease of endocytotic activity. 1 Publication

Organism-specific databases

PharmGKBiPA26190.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4141Sequence AnalysisAdd
BLAST
Chaini42 – 11561115Scavenger receptor cysteine-rich type 1 protein M130PRO_0000238938Add
BLAST
Chaini42 – ?Soluble CD163PRO_0000238939

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
Glycosylationi105 – 1051N-linked (GlcNAc...) (complex)3 Publications
Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
Glycosylationi140 – 1401N-linked (GlcNAc...)1 Publication
Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
Glycosylationi767 – 7671N-linked (GlcNAc...)1 Publication
Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation
Glycosylationi1027 – 10271N-linked (GlcNAc...)1 Publication

Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.4 Publications
Phosphorylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ86VB7.
PRIDEiQ86VB7.

PTM databases

PhosphoSiteiQ86VB7.

Expressioni

Tissue specificityi

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

Inductioni

Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

Gene expression databases

BgeeiQ86VB7.
CleanExiHS_CD163.
ExpressionAtlasiQ86VB7. baseline and differential.
GenevestigatoriQ86VB7.

Organism-specific databases

HPAiCAB002432.

Interactioni

Subunit structurei

Interacts with CSNK2B.1 Publication

Protein-protein interaction databases

BioGridi114741. 2 interactions.
IntActiQ86VB7. 1 interaction.
STRINGi9606.ENSP00000352071.

Structurei

3D structure databases

ProteinModelPortaliQ86VB7.
SMRiQ86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini42 – 10501009ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1072 – 115685CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1051 – 107121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 152102SRCR 1PROSITE-ProRule annotationAdd
BLAST
Domaini159 – 259101SRCR 2PROSITE-ProRule annotationAdd
BLAST
Domaini266 – 366101SRCR 3PROSITE-ProRule annotationAdd
BLAST
Domaini373 – 473101SRCR 4PROSITE-ProRule annotationAdd
BLAST
Domaini478 – 578101SRCR 5PROSITE-ProRule annotationAdd
BLAST
Domaini583 – 683101SRCR 6PROSITE-ProRule annotationAdd
BLAST
Domaini719 – 819101SRCR 7PROSITE-ProRule annotationAdd
BLAST
Domaini824 – 926103SRCR 8PROSITE-ProRule annotationAdd
BLAST
Domaini929 – 1029101SRCR 9PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1096 – 10994Internalization signal

Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

Sequence similaritiesi

Contains 9 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG83796.
GeneTreeiENSGT00760000118953.
HOVERGENiHBG080943.
InParanoidiQ86VB7.
KOiK06545.
OMAiSVSCQGH.
OrthoDBiEOG7RNK07.
PhylomeDBiQ86VB7.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 9 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 9 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 9 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 9 hits.
PROSITEiPS00420. SRCR_1. 4 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86VB7) [UniParc]FASTAAdd to Basket

Also known as: Long tail variant 1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE
60 70 80 90 100
LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA
110 120 130 140 150
PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT
160 170 180 190 200
CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL
210 220 230 240 250
ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH
260 270 280 290 300
AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA
310 320 330 340 350
AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW
360 370 380 390 400
GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR
410 420 430 440 450
GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW
460 470 480 490 500
DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG
510 520 530 540 550
SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH
560 570 580 590 600
ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT
610 620 630 640 650
LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF
660 670 680 690 700
HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP
710 720 730 740 750
TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL
760 770 780 790 800
SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS
810 820 830 840 850
HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV
860 870 880 890 900
GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD
910 920 930 940 950
TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW
960 970 980 990 1000
GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG
1010 1020 1030 1040 1050
NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS
1060 1070 1080 1090 1100
FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN
1110 1120 1130 1140 1150
SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE

KENGNL
Length:1,156
Mass (Da):125,451
Last modified:November 30, 2010 - v2
Checksum:i57B49F76DA6C96EB
GO
Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to Basket

Also known as: Long tail variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

Show »
Length:1,161
Mass (Da):125,982
Checksum:iDD1C93863FD07979
GO
Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to Basket

Also known as: Short tail variant

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,121
Mass (Da):121,609
Checksum:i31279FC947960606
GO
Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,154
Mass (Da):124,958
Checksum:i8814E05FB2EDFE7B
GO

Sequence cautioni

The sequence CAA80541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80542.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80544.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAB45233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti342 – 3421I → V.4 Publications
Corresponds to variant rs4883263 [ dbSNP | Ensembl ].
VAR_026574

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei579 – 5791R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. 1 PublicationVSP_019013
Alternative sequencei1115 – 115642ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. 1 PublicationVSP_019014Add
BLAST
Alternative sequencei1115 – 115642ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. 2 PublicationsVSP_019015Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22968 mRNA. Translation: CAA80541.1. Different initiation.
Z22969 mRNA. Translation: CAA80542.1. Different initiation.
Z22970 mRNA. Translation: CAA80543.1. Different initiation.
Z22971 mRNA. Translation: CAA80544.1. Different initiation.
Y18388
, Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA. Translation: CAB45233.1. Different initiation.
DQ058615 mRNA. Translation: AAY99762.1.
AC131206 Genomic DNA. No translation available.
BC051281 mRNA. Translation: AAH51281.1.
CCDSiCCDS53742.1. [Q86VB7-3]
CCDS8578.1. [Q86VB7-1]
PIRiI38004.
I38005.
I38006.
RefSeqiNP_004235.4. NM_004244.5. [Q86VB7-1]
NP_981961.2. NM_203416.3. [Q86VB7-3]
UniGeneiHs.504641.

Genome annotation databases

EnsembliENST00000359156; ENSP00000352071; ENSG00000177575. [Q86VB7-1]
ENST00000432237; ENSP00000403885; ENSG00000177575. [Q86VB7-3]
GeneIDi9332.
KEGGihsa:9332.
UCSCiuc001qsz.3. human. [Q86VB7-1]
uc001qta.3. human. [Q86VB7-3]

Polymorphism databases

DMDMi313104083.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22968 mRNA. Translation: CAA80541.1 . Different initiation.
Z22969 mRNA. Translation: CAA80542.1 . Different initiation.
Z22970 mRNA. Translation: CAA80543.1 . Different initiation.
Z22971 mRNA. Translation: CAA80544.1 . Different initiation.
Y18388
, Y18389 , Y18390 , Y18391 , Y18392 , Y18393 , Y18394 , Y18395 , Y18396 , Y18397 , Y18398 , Y18399 , Y18400 , Y18401 , Y18402 , Y18403 Genomic DNA. Translation: CAB45233.1 . Different initiation.
DQ058615 mRNA. Translation: AAY99762.1 .
AC131206 Genomic DNA. No translation available.
BC051281 mRNA. Translation: AAH51281.1 .
CCDSi CCDS53742.1. [Q86VB7-3 ]
CCDS8578.1. [Q86VB7-1 ]
PIRi I38004.
I38005.
I38006.
RefSeqi NP_004235.4. NM_004244.5. [Q86VB7-1 ]
NP_981961.2. NM_203416.3. [Q86VB7-3 ]
UniGenei Hs.504641.

3D structure databases

ProteinModelPortali Q86VB7.
SMRi Q86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114741. 2 interactions.
IntActi Q86VB7. 1 interaction.
STRINGi 9606.ENSP00000352071.

Chemistry

DrugBanki DB05389. WF10.

PTM databases

PhosphoSitei Q86VB7.

Polymorphism databases

DMDMi 313104083.

Proteomic databases

PaxDbi Q86VB7.
PRIDEi Q86VB7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359156 ; ENSP00000352071 ; ENSG00000177575 . [Q86VB7-1 ]
ENST00000432237 ; ENSP00000403885 ; ENSG00000177575 . [Q86VB7-3 ]
GeneIDi 9332.
KEGGi hsa:9332.
UCSCi uc001qsz.3. human. [Q86VB7-1 ]
uc001qta.3. human. [Q86VB7-3 ]

Organism-specific databases

CTDi 9332.
GeneCardsi GC12M007623.
HGNCi HGNC:1631. CD163.
HPAi CAB002432.
MIMi 605545. gene.
neXtProti NX_Q86VB7.
PharmGKBi PA26190.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG83796.
GeneTreei ENSGT00760000118953.
HOVERGENi HBG080943.
InParanoidi Q86VB7.
KOi K06545.
OMAi SVSCQGH.
OrthoDBi EOG7RNK07.
PhylomeDBi Q86VB7.
TreeFami TF329295.

Enzyme and pathway databases

Reactomei REACT_160163. Scavenging of heme from plasma.

Miscellaneous databases

ChiTaRSi CD163. human.
GeneWikii CD163.
GenomeRNAii 9332.
NextBioi 34955.
PROi Q86VB7.
SOURCEi Search...

Gene expression databases

Bgeei Q86VB7.
CleanExi HS_CD163.
ExpressionAtlasi Q86VB7. baseline and differential.
Genevestigatori Q86VB7.

Family and domain databases

Gene3Di 3.10.250.10. 9 hits.
InterProi IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view ]
Pfami PF00530. SRCR. 9 hits.
[Graphical view ]
PRINTSi PR00258. SPERACTRCPTR.
SMARTi SM00202. SR. 9 hits.
[Graphical view ]
SUPFAMi SSF56487. SSF56487. 9 hits.
PROSITEi PS00420. SRCR_1. 4 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily."
    Law S.K.A., Micklem K.J., Shaw J.M., Zhang X.-P., Dong Y., Willis A.C., Mason D.Y.
    Eur. J. Immunol. 23:2320-2325(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT VAL-342.
  2. "Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily."
    Ritter M., Buechler C., Langmann T., Schmitz G.
    Biochem. Biophys. Res. Commun. 260:466-474(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-342.
  3. "Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses."
    Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT VAL-342.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-342.
    Tissue: Spleen.
  6. "Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family."
    Droste A., Sorg C., Hogger P.
    Biochem. Biophys. Res. Commun. 256:110-113(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  7. "Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation."
    Van den Heuvel M.M., Tensen C.P., van As J.H., Van den Berg T.K., Fluitsma D.M., Dijkstra C.D., Dopp E.A., Droste A., Van Gaalen F.A., Sorg C., Hoegger P., Beelen R.H.J.
    J. Leukoc. Biol. 66:858-866(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION.
  8. "Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli."
    Buechler C., Ritter M., Orso E., Langmann T., Klucken J., Schmitz G.
    J. Leukoc. Biol. 67:97-103(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, SUBCELLULAR LOCATION.
  9. "Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C."
    Ritter M., Buechler C., Kapinsky M., Schmitz G.
    Eur. J. Immunol. 31:999-1009(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF THR-1072 AND SER-1084, INTERACTION WITH CSNK2B.
  10. Cited for: FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, IDENTIFICATION BY MASS SPECTROMETRY.
  11. "Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3."
    Matsushita N., Kashiwagi M., Wait R., Nagayoshi R., Nakamura M., Matsuda T., Hogger P., Guyre P.M., Nagase H., Matsuyama T.
    Clin. Exp. Immunol. 130:156-161(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  12. "Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect."
    Frings W., Dreier J., Sorg C.
    FEBS Lett. 526:93-96(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  13. "Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163."
    Hintz K.A., Rassias A.J., Wardwell K., Moss M.L., Morganelli P.M., Pioli P.A., Givan A.L., Wallace P.K., Yeager M.P., Guyre P.M.
    J. Leukoc. Biol. 72:711-717(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: MISCELLANEOUS.
  14. "CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response."
    Moestrup S.K., Moller H.J.
    Ann. Med. 36:347-354(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: RELEVANCE AS DISEASE MARKER IN INFLAMMATORY CONDITIONS.
  15. "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region."
    Madsen M., Moller H.J., Nielsen M.J., Jacobsen C., Graversen J.H., van den Berg T., Moestrup S.K.
    J. Biol. Chem. 279:51561-51567(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: DOMAIN, CLEAVAGE SITES.
  16. "Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163."
    Sulahian T.H., Pioli P.A., Wardwell K., Guyre P.M.
    J. Leukoc. Biol. 76:271-277(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  17. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105.
    Tissue: Plasma.
  18. "The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants."
    Nielsen M.J., Madsen M., Moller H.J., Moestrup S.K.
    J. Leukoc. Biol. 79:837-845(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF TYR-1096, TISSUE SPECIFICITY.
  19. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105; ASN-140; ASN-767 AND ASN-1027.
    Tissue: Liver.
  20. Cited for: GLYCOSYLATION AT ASN-105.

Entry informationi

Entry nameiC163A_HUMAN
AccessioniPrimary (citable) accession number: Q86VB7
Secondary accession number(s): C9JIG2
, Q07898, Q07899, Q07900, Q07901, Q2VLH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 30, 2010
Last modified: October 29, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3