Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q86VB7 (C163A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
Hemoglobin scavenger receptor
CD_antigen=CD163

Cleaved into the following chain:

  1. Soluble CD163
    Short name=sCD163
Gene names
Name:CD163
Synonyms:M130
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1156 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells. Ref.7 Ref.9 Ref.10 Ref.12 Ref.18

After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions. Ref.7 Ref.9 Ref.10 Ref.12 Ref.18

Subunit structure

Interacts with CSNK2B. Ref.9

Subcellular location

Soluble CD163: Secreted Ref.7 Ref.8.

Cell membrane; Single-pass type I membrane protein. Note: Isoform 1 and isoform 2 show a lower surface expression when expressed in cells. Ref.7 Ref.8

Tissue specificity

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detectedin the blood. Ref.7 Ref.10 Ref.18

Induction

Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF. Ref.7 Ref.8

Domain

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes. Ref.15

Post-translational modification

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.

Phosphorylated Probable. Ref.9

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.

The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Sequence similarities

Contains 9 SRCR domains.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.

Biophysicochemical properties

Kinetic parameters:

KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype Ref.10

KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype

Sequence caution

The sequence CAA80541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAA80542.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAA80543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAA80544.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAB45233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q86VB7-1)

Also known as: Long tail variant 1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q86VB7-2)

Also known as: Long tail variant 2;

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE
Isoform 3 (identifier: Q86VB7-3)

Also known as: Short tail variant;

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH
Isoform 4 (identifier: Q86VB7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 4141 Potential
Chain42 – 11561115Scavenger receptor cysteine-rich type 1 protein M130
PRO_0000238938
Chain42 – ?Soluble CD163PRO_0000238939

Regions

Topological domain42 – 10501009Extracellular Potential
Transmembrane1051 – 107121Helical; Potential
Topological domain1072 – 115685Cytoplasmic Potential
Domain51 – 152102SRCR 1
Domain159 – 259101SRCR 2
Domain266 – 366101SRCR 3
Domain373 – 473101SRCR 4
Domain478 – 578101SRCR 5
Domain583 – 683101SRCR 6
Domain719 – 819101SRCR 7
Domain824 – 926103SRCR 8
Domain929 – 1029101SRCR 9
Motif1096 – 10994Internalization signal

Sites

Site269 – 2702Cleavage; in calcium-free condition
Site281 – 2822Cleavage; in calcium-free condition
Site333 – 3342Cleavage; in calcium-free condition
Site360 – 3612Cleavage; in calcium-free condition

Amino acid modifications

Glycosylation1051N-linked (GlcNAc...) (complex) Ref.17 Ref.19 Ref.20
Glycosylation1401N-linked (GlcNAc...) Ref.19
Glycosylation7671N-linked (GlcNAc...) Ref.19
Glycosylation10271N-linked (GlcNAc...) Ref.19
Disulfide bond76 ↔ 141 By similarity
Disulfide bond89 ↔ 151 By similarity
Disulfide bond120 ↔ 130 By similarity
Disulfide bond184 ↔ 248 By similarity
Disulfide bond197 ↔ 258 By similarity
Disulfide bond228 ↔ 238 By similarity
Disulfide bond291 ↔ 355 By similarity
Disulfide bond304 ↔ 365 By similarity
Disulfide bond335 ↔ 345 By similarity
Disulfide bond398 ↔ 462 By similarity
Disulfide bond411 ↔ 472 By similarity
Disulfide bond442 ↔ 452 By similarity
Disulfide bond503 ↔ 567 By similarity
Disulfide bond516 ↔ 577 By similarity
Disulfide bond547 ↔ 557 By similarity
Disulfide bond608 ↔ 672 By similarity
Disulfide bond621 ↔ 682 By similarity
Disulfide bond652 ↔ 662 By similarity
Disulfide bond744 ↔ 808 By similarity
Disulfide bond757 ↔ 818 By similarity
Disulfide bond788 ↔ 798 By similarity
Disulfide bond864 ↔ 925 By similarity
Disulfide bond895 ↔ 905 By similarity
Disulfide bond954 ↔ 1018 By similarity
Disulfide bond967 ↔ 1028 By similarity
Disulfide bond998 ↔ 1008 By similarity

Natural variations

Alternative sequence5791R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4.
VSP_019013
Alternative sequence1115 – 115642ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2.
VSP_019014
Alternative sequence1115 – 115642ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4.
VSP_019015
Natural variant3421I → V. Ref.1 Ref.2 Ref.3 Ref.5
Corresponds to variant rs4883263 [ dbSNP | Ensembl ].
VAR_026574

Experimental info

Mutagenesis10721T → A: Impaired phosphorylation by PRKCA. Ref.9
Mutagenesis10841S → A: Impaired phosphorylation by PRKCA. Ref.9
Mutagenesis10961Y → A: Massive decrease of endocytotic activity. Ref.18

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Long tail variant 1) [UniParc].

Last modified November 30, 2010. Version 2.
Checksum: 57B49F76DA6C96EB

FASTA1,156125,451
        10         20         30         40         50         60 
MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE LRLVDGENKC 

        70         80         90        100        110        120 
SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA PGWANSSAGS GRIWMDHVSC 

       130        140        150        160        170        180 
RGNESALWDC KHDGWGKHSN CTHQQDAGVT CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW 

       190        200        210        220        230        240 
GTVCDDNFNI DHASVICRQL ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH 

       250        260        270        280        290        300 
QGWGKHNCDH AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 

       310        320        330        340        350        360 
AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW GKHYCNHNED 

       370        380        390        400        410        420 
AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR GWGLKEADVV CRQLGCGSAL 

       430        440        450        460        470        480 
KTSYQVYSKI QATNTWLFLS SCNGNETSLW DCKNWQWGGL TCDHYEEAKI TCSAHREPRL 

       490        500        510        520        530        540 
VGGDIPCSGR VEVKHGDTWG SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI 

       550        560        570        580        590        600 
WAEEFQCEGH ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 

       610        620        630        640        650        660 
LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF HCTGTEQHMG 

       670        680        690        700        710        720 
DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP TRPTIPEESA VACIESGQLR 

       730        740        750        760        770        780 
LVNGGGRCAG RVEIYHEGSW GTICDDSWDL SDAHVVCRQL GCGEAINATG SAHFGEGTGP 

       790        800        810        820        830        840 
IWLDEMKCNG KESRIWQCHS HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE 

       850        860        870        880        890        900 
VFYNGAWGTV GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 

       910        920        930        940        950        960 
TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW GTVCDDSWDL 

       970        980        990       1000       1010       1020 
DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG NESSLWDCPA RRWGHSECGH 

      1030       1040       1050       1060       1070       1080 
KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS FIAVGILGVV LLAIFVALFF LTKKRRQRQR 

      1090       1100       1110       1120       1130       1140 
LAVSSRGENL VHQIQYREMN SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM 

      1150 
EKEAILSHTE KENGNL 

« Hide

Isoform 2 (Long tail variant 2) [UniParc].

Checksum: DD1C93863FD07979
Show »

FASTA1,161125,982
Isoform 3 (Short tail variant) [UniParc].

Checksum: 31279FC947960606
Show »

FASTA1,121121,609
Isoform 4 [UniParc].

Checksum: 8814E05FB2EDFE7B
Show »

FASTA1,154124,958

References

« Hide 'large scale' references
[1]"A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily."
Law S.K.A., Micklem K.J., Shaw J.M., Zhang X.-P., Dong Y., Willis A.C., Mason D.Y.
Eur. J. Immunol. 23:2320-2325(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT VAL-342.
[2]"Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily."
Ritter M., Buechler C., Langmann T., Schmitz G.
Biochem. Biophys. Res. Commun. 260:466-474(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-342.
[3]"Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses."
Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L.
Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT VAL-342.
[4]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-342.
Tissue: Spleen.
[6]"Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family."
Droste A., Sorg C., Hogger P.
Biochem. Biophys. Res. Commun. 256:110-113(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: CLEAVAGE.
[7]"Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation."
Van den Heuvel M.M., Tensen C.P., van As J.H., Van den Berg T.K., Fluitsma D.M., Dijkstra C.D., Dopp E.A., Droste A., Van Gaalen F.A., Sorg C., Hoegger P., Beelen R.H.J.
J. Leukoc. Biol. 66:858-866(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION.
[8]"Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli."
Buechler C., Ritter M., Orso E., Langmann T., Klucken J., Schmitz G.
J. Leukoc. Biol. 67:97-103(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION, SUBCELLULAR LOCATION.
[9]"Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C."
Ritter M., Buechler C., Kapinsky M., Schmitz G.
Eur. J. Immunol. 31:999-1009(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF THR-1072 AND SER-1084, INTERACTION WITH CSNK2B.
[10]"Identification of the haemoglobin scavenger receptor."
Kristiansen M., Graversen J.H., Jacobsen C., Sonne O., Hoffman H.-J., Law S.K.A., Moestrup S.K.
Nature 409:198-201(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, IDENTIFICATION BY MASS SPECTROMETRY.
[11]"Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3."
Matsushita N., Kashiwagi M., Wait R., Nagayoshi R., Nakamura M., Matsuda T., Hogger P., Guyre P.M., Nagase H., Matsuyama T.
Clin. Exp. Immunol. 130:156-161(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: CLEAVAGE.
[12]"Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect."
Frings W., Dreier J., Sorg C.
FEBS Lett. 526:93-96(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[13]"Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163."
Hintz K.A., Rassias A.J., Wardwell K., Moss M.L., Morganelli P.M., Pioli P.A., Givan A.L., Wallace P.K., Yeager M.P., Guyre P.M.
J. Leukoc. Biol. 72:711-717(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: MISCELLANEOUS.
[14]"CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response."
Moestrup S.K., Moller H.J.
Ann. Med. 36:347-354(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: RELEVANCE AS DISEASE MARKER IN INFLAMMATORY CONDITIONS.
[15]"Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region."
Madsen M., Moller H.J., Nielsen M.J., Jacobsen C., Graversen J.H., van den Berg T., Moestrup S.K.
J. Biol. Chem. 279:51561-51567(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: DOMAIN, CLEAVAGE SITES.
[16]"Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163."
Sulahian T.H., Pioli P.A., Wardwell K., Guyre P.M.
J. Leukoc. Biol. 76:271-277(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: CLEAVAGE.
[17]"Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105.
Tissue: Plasma.
[18]"The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants."
Nielsen M.J., Madsen M., Moller H.J., Moestrup S.K.
J. Leukoc. Biol. 79:837-845(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, MUTAGENESIS OF TYR-1096, TISSUE SPECIFICITY.
[19]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105; ASN-140; ASN-767 AND ASN-1027.
Tissue: Liver.
[20]"A strategy for precise and large scale identification of core fucosylated glycoproteins."
Jia W., Lu Z., Fu Y., Wang H.P., Wang L.H., Chi H., Yuan Z.F., Zheng Z.B., Song L.N., Han H.H., Liang Y.M., Wang J.L., Cai Y., Zhang Y.K., Deng Y.L., Ying W.T., He S.M., Qian X.H.
Mol. Cell. Proteomics 8:913-923(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION AT ASN-105.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z22968 mRNA. Translation: CAA80541.1. Different initiation.
Z22969 mRNA. Translation: CAA80542.1. Different initiation.
Z22970 mRNA. Translation: CAA80543.1. Different initiation.
Z22971 mRNA. Translation: CAA80544.1. Different initiation.
Y18388 expand/collapse EMBL AC list , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA. Translation: CAB45233.1. Different initiation.
DQ058615 mRNA. Translation: AAY99762.1.
AC131206 Genomic DNA. No translation available.
BC051281 mRNA. Translation: AAH51281.1.
PIRI38004.
I38005.
I38006.
RefSeqNP_004235.4. NM_004244.5.
NP_981961.2. NM_203416.3.
UniGeneHs.504641.

3D structure databases

ProteinModelPortalQ86VB7.
SMRQ86VB7. Positions 48-264, 277-366, 373-473, 479-683, 715-821, 837-1030.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114741. 2 interactions.
IntActQ86VB7. 1 interaction.
STRING9606.ENSP00000352071.

PTM databases

PhosphoSiteQ86VB7.

Polymorphism databases

DMDM313104083.

Proteomic databases

PaxDbQ86VB7.
PRIDEQ86VB7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359156; ENSP00000352071; ENSG00000177575. [Q86VB7-1]
ENST00000432237; ENSP00000403885; ENSG00000177575. [Q86VB7-3]
GeneID9332.
KEGGhsa:9332.
UCSCuc001qsz.3. human. [Q86VB7-1]
uc001qta.3. human. [Q86VB7-3]

Organism-specific databases

CTD9332.
GeneCardsGC12M007623.
HGNCHGNC:1631. CD163.
HPACAB002432.
MIM605545. gene.
neXtProtNX_Q86VB7.
PharmGKBPA26190.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG83796.
HOVERGENHBG080943.
InParanoidQ86VB7.
KOK06545.
OMASVSCQGH.
OrthoDBEOG7RNK07.
PhylomeDBQ86VB7.
TreeFamTF329295.

Enzyme and pathway databases

ReactomeREACT_160300. Binding and Uptake of Ligands by Scavenger Receptors.

Gene expression databases

ArrayExpressQ86VB7.
BgeeQ86VB7.
CleanExHS_CD163.
GenevestigatorQ86VB7.

Family and domain databases

Gene3D3.10.250.10. 9 hits.
InterProIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamPF00530. SRCR. 9 hits.
[Graphical view]
PRINTSPR00258. SPERACTRCPTR.
SMARTSM00202. SR. 9 hits.
[Graphical view]
SUPFAMSSF56487. SSF56487. 9 hits.
PROSITEPS00420. SRCR_1. 4 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCD163. human.
GeneWikiCD163.
GenomeRNAi9332.
NextBio34955.
PROQ86VB7.
SOURCESearch...

Entry information

Entry nameC163A_HUMAN
AccessionPrimary (citable) accession number: Q86VB7
Secondary accession number(s): C9JIG2 expand/collapse secondary AC list , Q07898, Q07899, Q07900, Q07901, Q2VLH7
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 30, 2010
Last modified: April 16, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries