SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86VB7

- C163A_HUMAN

UniProt

Q86VB7 - C163A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Scavenger receptor cysteine-rich type 1 protein M130
Gene
CD163, M130
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.5 Publications
After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.5 Publications

Kineticsi

  1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
  2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei269 – 2702Cleavage; in calcium-free condition
Sitei281 – 2822Cleavage; in calcium-free condition
Sitei333 – 3342Cleavage; in calcium-free condition
Sitei360 – 3612Cleavage; in calcium-free condition

GO - Molecular functioni

  1. protein binding Source: UniProtKB
  2. scavenger receptor activity Source: UniProtKB

GO - Biological processi

  1. acute-phase response Source: UniProtKB-KW
  2. receptor-mediated endocytosis Source: GOC
Complete GO annotation...

Keywords - Biological processi

Acute phase, Inflammatory response

Enzyme and pathway databases

ReactomeiREACT_160163. Scavenging of heme from plasma.

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
Hemoglobin scavenger receptor
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
Gene namesi
Name:CD163
Synonyms:M130
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:1631. CD163.

Subcellular locationi

Chain Soluble CD163 : Secreted 2 Publications
Cell membrane; Single-pass type I membrane protein
Note: Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini42 – 10501009Extracellular Reviewed prediction
Add
BLAST
Transmembranei1051 – 107121Helical; Reviewed prediction
Add
BLAST
Topological domaini1072 – 115685Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. endocytic vesicle membrane Source: Reactome
  2. extracellular region Source: UniProtKB-SubCell
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1072 – 10721T → A: Impaired phosphorylation by PRKCA. 1 Publication
Mutagenesisi1084 – 10841S → A: Impaired phosphorylation by PRKCA. 1 Publication
Mutagenesisi1096 – 10961Y → A: Massive decrease of endocytotic activity. 1 Publication

Organism-specific databases

PharmGKBiPA26190.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4141 Reviewed prediction
Add
BLAST
Chaini42 – 11561115Scavenger receptor cysteine-rich type 1 protein M130
PRO_0000238938Add
BLAST
Chaini42 – ?Soluble CD163PRO_0000238939

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi76 ↔ 141 By similarity
Disulfide bondi89 ↔ 151 By similarity
Glycosylationi105 – 1051N-linked (GlcNAc...) (complex)3 Publications
Disulfide bondi120 ↔ 130 By similarity
Glycosylationi140 – 1401N-linked (GlcNAc...)1 Publication
Disulfide bondi184 ↔ 248 By similarity
Disulfide bondi197 ↔ 258 By similarity
Disulfide bondi228 ↔ 238 By similarity
Disulfide bondi291 ↔ 355 By similarity
Disulfide bondi304 ↔ 365 By similarity
Disulfide bondi335 ↔ 345 By similarity
Disulfide bondi398 ↔ 462 By similarity
Disulfide bondi411 ↔ 472 By similarity
Disulfide bondi442 ↔ 452 By similarity
Disulfide bondi503 ↔ 567 By similarity
Disulfide bondi516 ↔ 577 By similarity
Disulfide bondi547 ↔ 557 By similarity
Disulfide bondi608 ↔ 672 By similarity
Disulfide bondi621 ↔ 682 By similarity
Disulfide bondi652 ↔ 662 By similarity
Disulfide bondi744 ↔ 808 By similarity
Disulfide bondi757 ↔ 818 By similarity
Glycosylationi767 – 7671N-linked (GlcNAc...)1 Publication
Disulfide bondi788 ↔ 798 By similarity
Disulfide bondi864 ↔ 925 By similarity
Disulfide bondi895 ↔ 905 By similarity
Disulfide bondi954 ↔ 1018 By similarity
Disulfide bondi967 ↔ 1028 By similarity
Disulfide bondi998 ↔ 1008 By similarity
Glycosylationi1027 – 10271N-linked (GlcNAc...)1 Publication

Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.
Phosphorylated Inferred.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ86VB7.
PRIDEiQ86VB7.

PTM databases

PhosphoSiteiQ86VB7.

Expressioni

Tissue specificityi

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

Inductioni

Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

Gene expression databases

ArrayExpressiQ86VB7.
BgeeiQ86VB7.
CleanExiHS_CD163.
GenevestigatoriQ86VB7.

Organism-specific databases

HPAiCAB002432.

Interactioni

Subunit structurei

Interacts with CSNK2B.1 Publication

Protein-protein interaction databases

BioGridi114741. 2 interactions.
IntActiQ86VB7. 1 interaction.
STRINGi9606.ENSP00000352071.

Structurei

3D structure databases

ProteinModelPortaliQ86VB7.
SMRiQ86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 152102SRCR 1
Add
BLAST
Domaini159 – 259101SRCR 2
Add
BLAST
Domaini266 – 366101SRCR 3
Add
BLAST
Domaini373 – 473101SRCR 4
Add
BLAST
Domaini478 – 578101SRCR 5
Add
BLAST
Domaini583 – 683101SRCR 6
Add
BLAST
Domaini719 – 819101SRCR 7
Add
BLAST
Domaini824 – 926103SRCR 8
Add
BLAST
Domaini929 – 1029101SRCR 9
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi1096 – 10994Internalization signal

Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

Sequence similaritiesi

Contains 9 SRCR domains.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG83796.
HOVERGENiHBG080943.
InParanoidiQ86VB7.
KOiK06545.
OMAiSVSCQGH.
OrthoDBiEOG7RNK07.
PhylomeDBiQ86VB7.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 9 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 9 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 9 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 9 hits.
PROSITEiPS00420. SRCR_1. 4 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86VB7-1) [UniParc]FASTAAdd to Basket

Also known as: Long tail variant 1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE     50
LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA 100
PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT 150
CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL 200
ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH 250
AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 300
AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW 350
GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR 400
GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW 450
DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG 500
SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH 550
ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 600
LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF 650
HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP 700
TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL 750
SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS 800
HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV 850
GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 900
TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW 950
GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG 1000
NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS 1050
FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN 1100
SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE 1150
KENGNL 1156
Length:1,156
Mass (Da):125,451
Last modified:November 30, 2010 - v2
Checksum:i57B49F76DA6C96EB
GO
Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to Basket

Also known as: Long tail variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

Show »
Length:1,161
Mass (Da):125,982
Checksum:iDD1C93863FD07979
GO
Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to Basket

Also known as: Short tail variant

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,121
Mass (Da):121,609
Checksum:i31279FC947960606
GO
Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
     1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

Show »
Length:1,154
Mass (Da):124,958
Checksum:i8814E05FB2EDFE7B
GO

Sequence cautioni

The sequence CAA80541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80542.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAA80544.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence CAB45233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti342 – 3421I → V.4 Publications
Corresponds to variant rs4883263 [ dbSNP | Ensembl ].
VAR_026574

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei579 – 5791R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4.
VSP_019013
Alternative sequencei1115 – 115642ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2.
VSP_019014Add
BLAST
Alternative sequencei1115 – 115642ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4.
VSP_019015Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22968 mRNA. Translation: CAA80541.1. Different initiation.
Z22969 mRNA. Translation: CAA80542.1. Different initiation.
Z22970 mRNA. Translation: CAA80543.1. Different initiation.
Z22971 mRNA. Translation: CAA80544.1. Different initiation.
Y18388
, Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA. Translation: CAB45233.1. Different initiation.
DQ058615 mRNA. Translation: AAY99762.1.
AC131206 Genomic DNA. No translation available.
BC051281 mRNA. Translation: AAH51281.1.
CCDSiCCDS53742.1. [Q86VB7-3]
CCDS8578.1. [Q86VB7-1]
PIRiI38004.
I38005.
I38006.
RefSeqiNP_004235.4. NM_004244.5. [Q86VB7-1]
NP_981961.2. NM_203416.3. [Q86VB7-3]
UniGeneiHs.504641.

Genome annotation databases

EnsembliENST00000359156; ENSP00000352071; ENSG00000177575. [Q86VB7-1]
ENST00000432237; ENSP00000403885; ENSG00000177575. [Q86VB7-3]
GeneIDi9332.
KEGGihsa:9332.
UCSCiuc001qsz.3. human. [Q86VB7-1]
uc001qta.3. human. [Q86VB7-3]

Polymorphism databases

DMDMi313104083.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22968 mRNA. Translation: CAA80541.1 . Different initiation.
Z22969 mRNA. Translation: CAA80542.1 . Different initiation.
Z22970 mRNA. Translation: CAA80543.1 . Different initiation.
Z22971 mRNA. Translation: CAA80544.1 . Different initiation.
Y18388
, Y18389 , Y18390 , Y18391 , Y18392 , Y18393 , Y18394 , Y18395 , Y18396 , Y18397 , Y18398 , Y18399 , Y18400 , Y18401 , Y18402 , Y18403 Genomic DNA. Translation: CAB45233.1 . Different initiation.
DQ058615 mRNA. Translation: AAY99762.1 .
AC131206 Genomic DNA. No translation available.
BC051281 mRNA. Translation: AAH51281.1 .
CCDSi CCDS53742.1. [Q86VB7-3 ]
CCDS8578.1. [Q86VB7-1 ]
PIRi I38004.
I38005.
I38006.
RefSeqi NP_004235.4. NM_004244.5. [Q86VB7-1 ]
NP_981961.2. NM_203416.3. [Q86VB7-3 ]
UniGenei Hs.504641.

3D structure databases

ProteinModelPortali Q86VB7.
SMRi Q86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114741. 2 interactions.
IntActi Q86VB7. 1 interaction.
STRINGi 9606.ENSP00000352071.

PTM databases

PhosphoSitei Q86VB7.

Polymorphism databases

DMDMi 313104083.

Proteomic databases

PaxDbi Q86VB7.
PRIDEi Q86VB7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359156 ; ENSP00000352071 ; ENSG00000177575 . [Q86VB7-1 ]
ENST00000432237 ; ENSP00000403885 ; ENSG00000177575 . [Q86VB7-3 ]
GeneIDi 9332.
KEGGi hsa:9332.
UCSCi uc001qsz.3. human. [Q86VB7-1 ]
uc001qta.3. human. [Q86VB7-3 ]

Organism-specific databases

CTDi 9332.
GeneCardsi GC12M007623.
HGNCi HGNC:1631. CD163.
HPAi CAB002432.
MIMi 605545. gene.
neXtProti NX_Q86VB7.
PharmGKBi PA26190.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG83796.
HOVERGENi HBG080943.
InParanoidi Q86VB7.
KOi K06545.
OMAi SVSCQGH.
OrthoDBi EOG7RNK07.
PhylomeDBi Q86VB7.
TreeFami TF329295.

Enzyme and pathway databases

Reactomei REACT_160163. Scavenging of heme from plasma.

Miscellaneous databases

ChiTaRSi CD163. human.
GeneWikii CD163.
GenomeRNAii 9332.
NextBioi 34955.
PROi Q86VB7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q86VB7.
Bgeei Q86VB7.
CleanExi HS_CD163.
Genevestigatori Q86VB7.

Family and domain databases

Gene3Di 3.10.250.10. 9 hits.
InterProi IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view ]
Pfami PF00530. SRCR. 9 hits.
[Graphical view ]
PRINTSi PR00258. SPERACTRCPTR.
SMARTi SM00202. SR. 9 hits.
[Graphical view ]
SUPFAMi SSF56487. SSF56487. 9 hits.
PROSITEi PS00420. SRCR_1. 4 hits.
PS50287. SRCR_2. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily."
    Law S.K.A., Micklem K.J., Shaw J.M., Zhang X.-P., Dong Y., Willis A.C., Mason D.Y.
    Eur. J. Immunol. 23:2320-2325(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT VAL-342.
  2. "Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily."
    Ritter M., Buechler C., Langmann T., Schmitz G.
    Biochem. Biophys. Res. Commun. 260:466-474(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-342.
  3. "Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses."
    Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT VAL-342.
  4. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-342.
    Tissue: Spleen.
  6. "Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family."
    Droste A., Sorg C., Hogger P.
    Biochem. Biophys. Res. Commun. 256:110-113(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  7. "Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation."
    Van den Heuvel M.M., Tensen C.P., van As J.H., Van den Berg T.K., Fluitsma D.M., Dijkstra C.D., Dopp E.A., Droste A., Van Gaalen F.A., Sorg C., Hoegger P., Beelen R.H.J.
    J. Leukoc. Biol. 66:858-866(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION.
  8. "Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli."
    Buechler C., Ritter M., Orso E., Langmann T., Klucken J., Schmitz G.
    J. Leukoc. Biol. 67:97-103(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, SUBCELLULAR LOCATION.
  9. "Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C."
    Ritter M., Buechler C., Kapinsky M., Schmitz G.
    Eur. J. Immunol. 31:999-1009(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF THR-1072 AND SER-1084, INTERACTION WITH CSNK2B.
  10. Cited for: FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, IDENTIFICATION BY MASS SPECTROMETRY.
  11. "Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3."
    Matsushita N., Kashiwagi M., Wait R., Nagayoshi R., Nakamura M., Matsuda T., Hogger P., Guyre P.M., Nagase H., Matsuyama T.
    Clin. Exp. Immunol. 130:156-161(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  12. "Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect."
    Frings W., Dreier J., Sorg C.
    FEBS Lett. 526:93-96(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  13. "Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163."
    Hintz K.A., Rassias A.J., Wardwell K., Moss M.L., Morganelli P.M., Pioli P.A., Givan A.L., Wallace P.K., Yeager M.P., Guyre P.M.
    J. Leukoc. Biol. 72:711-717(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: MISCELLANEOUS.
  14. "CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response."
    Moestrup S.K., Moller H.J.
    Ann. Med. 36:347-354(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: RELEVANCE AS DISEASE MARKER IN INFLAMMATORY CONDITIONS.
  15. "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region."
    Madsen M., Moller H.J., Nielsen M.J., Jacobsen C., Graversen J.H., van den Berg T., Moestrup S.K.
    J. Biol. Chem. 279:51561-51567(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: DOMAIN, CLEAVAGE SITES.
  16. "Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163."
    Sulahian T.H., Pioli P.A., Wardwell K., Guyre P.M.
    J. Leukoc. Biol. 76:271-277(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: CLEAVAGE.
  17. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105.
    Tissue: Plasma.
  18. "The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants."
    Nielsen M.J., Madsen M., Moller H.J., Moestrup S.K.
    J. Leukoc. Biol. 79:837-845(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF TYR-1096, TISSUE SPECIFICITY.
  19. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105; ASN-140; ASN-767 AND ASN-1027.
    Tissue: Liver.
  20. Cited for: GLYCOSYLATION AT ASN-105.

Entry informationi

Entry nameiC163A_HUMAN
AccessioniPrimary (citable) accession number: Q86VB7
Secondary accession number(s): C9JIG2
, Q07898, Q07899, Q07900, Q07901, Q2VLH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: November 30, 2010
Last modified: September 3, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

Caution

It is uncertain whether Met-1 or Met-6 is the initiator.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi