Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86VB7

- C163A_HUMAN

UniProt

Q86VB7 - C163A_HUMAN

Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 2 (30 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.
    After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

    Kineticsi

    1. KM=2.0 nM for hemoglobin/haptoglobin of HP*1S phenotype1 Publication
    2. KM=0.2 nM for hemoglobin/haptoglobin of HP*1F phenotype1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei269 – 2702Cleavage; in calcium-free condition
    Sitei281 – 2822Cleavage; in calcium-free condition
    Sitei333 – 3342Cleavage; in calcium-free condition
    Sitei360 – 3612Cleavage; in calcium-free condition

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. scavenger receptor activity Source: UniProtKB

    GO - Biological processi

    1. acute-phase response Source: UniProtKB-KW
    2. receptor-mediated endocytosis Source: GOC

    Keywords - Biological processi

    Acute phase, Inflammatory response

    Enzyme and pathway databases

    ReactomeiREACT_160163. Scavenging of heme from plasma.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Scavenger receptor cysteine-rich type 1 protein M130
    Alternative name(s):
    Hemoglobin scavenger receptor
    CD_antigen: CD163
    Cleaved into the following chain:
    Soluble CD163
    Short name:
    sCD163
    Gene namesi
    Name:CD163
    Synonyms:M130
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:1631. CD163.

    Subcellular locationi

    Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications
    Note: Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.

    GO - Cellular componenti

    1. endocytic vesicle membrane Source: Reactome
    2. extracellular region Source: UniProtKB-SubCell
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi1072 – 10721T → A: Impaired phosphorylation by PRKCA. 1 Publication
    Mutagenesisi1084 – 10841S → A: Impaired phosphorylation by PRKCA. 1 Publication
    Mutagenesisi1096 – 10961Y → A: Massive decrease of endocytotic activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA26190.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 4141Sequence AnalysisAdd
    BLAST
    Chaini42 – 11561115Scavenger receptor cysteine-rich type 1 protein M130PRO_0000238938Add
    BLAST
    Chaini42 – ?Soluble CD163PRO_0000238939

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
    Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
    Glycosylationi105 – 1051N-linked (GlcNAc...) (complex)3 Publications
    Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
    Glycosylationi140 – 1401N-linked (GlcNAc...)1 Publication
    Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
    Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
    Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
    Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
    Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
    Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
    Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
    Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
    Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
    Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
    Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
    Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
    Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
    Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
    Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
    Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
    Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
    Glycosylationi767 – 7671N-linked (GlcNAc...)1 Publication
    Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
    Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
    Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
    Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
    Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
    Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation
    Glycosylationi1027 – 10271N-linked (GlcNAc...)1 Publication

    Post-translational modificationi

    A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.4 Publications
    Phosphorylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ86VB7.
    PRIDEiQ86VB7.

    PTM databases

    PhosphoSiteiQ86VB7.

    Expressioni

    Tissue specificityi

    Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.3 Publications

    Inductioni

    Induced by anti-inflammatory mediators such as glucocorticoids, interleukin-6/IL6 and interleukin-10/IL10; suppressed by proinflammatory mediators like bacterial lipopolysaccharides (LPS), IFNG/IFN-gamma and TNF.2 Publications

    Gene expression databases

    ArrayExpressiQ86VB7.
    BgeeiQ86VB7.
    CleanExiHS_CD163.
    GenevestigatoriQ86VB7.

    Organism-specific databases

    HPAiCAB002432.

    Interactioni

    Subunit structurei

    Interacts with CSNK2B.1 Publication

    Protein-protein interaction databases

    BioGridi114741. 2 interactions.
    IntActiQ86VB7. 1 interaction.
    STRINGi9606.ENSP00000352071.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86VB7.
    SMRiQ86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini42 – 10501009ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1072 – 115685CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1051 – 107121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini51 – 152102SRCR 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini159 – 259101SRCR 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini266 – 366101SRCR 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini373 – 473101SRCR 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini478 – 578101SRCR 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini583 – 683101SRCR 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini719 – 819101SRCR 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini824 – 926103SRCR 8PROSITE-ProRule annotationAdd
    BLAST
    Domaini929 – 1029101SRCR 9PROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi1096 – 10994Internalization signal

    Domaini

    The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.1 Publication

    Sequence similaritiesi

    Contains 9 SRCR domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG83796.
    HOVERGENiHBG080943.
    InParanoidiQ86VB7.
    KOiK06545.
    OMAiSVSCQGH.
    OrthoDBiEOG7RNK07.
    PhylomeDBiQ86VB7.
    TreeFamiTF329295.

    Family and domain databases

    Gene3Di3.10.250.10. 9 hits.
    InterProiIPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view]
    PfamiPF00530. SRCR. 9 hits.
    [Graphical view]
    PRINTSiPR00258. SPERACTRCPTR.
    SMARTiSM00202. SR. 9 hits.
    [Graphical view]
    SUPFAMiSSF56487. SSF56487. 9 hits.
    PROSITEiPS00420. SRCR_1. 4 hits.
    PS50287. SRCR_2. 9 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86VB7-1) [UniParc]FASTAAdd to Basket

    Also known as: Long tail variant 1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSKLRMVLLE DSGSADFRRH FVNLSPFTIT VVLLLSACFV TSSLGGTDKE     50
    LRLVDGENKC SGRVEVKVQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA 100
    PGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT 150
    CSDGSNLEMR LTRGGNMCSG RIEIKFQGRW GTVCDDNFNI DHASVICRQL 200
    ECGSAVSFSG SSNFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH 250
    AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSYDA 300
    AVACKQLGCP TAVTAIGRVN ASKGFGHIWL DSVSCQGHEP AIWQCKHHEW 350
    GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR 400
    GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNTWLFLS SCNGNETSLW 450
    DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG 500
    SICDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WAEEFQCEGH 550
    ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT 600
    LGAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGARFGK GNGQIWRHMF 650
    HCTGTEQHMG DCPVTALGAS LCPSEQVASV ICSGNQSQTL SSCNSSSLGP 700
    TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL 750
    SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS 800
    HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGTV 850
    GKSSMSETTV GVVCRQLGCA DKGKINPASL DKAMSIPMWV DNVQCPKGPD 900
    TLWQCPSSPW EKRLASPSEE TWITCDNKIR LQEGPTSCSG RVEIWHGGSW 950
    GTVCDDSWDL DDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG 1000
    NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISVQKTPQKA TTGRSSRQSS 1050
    FIAVGILGVV LLAIFVALFF LTKKRRQRQR LAVSSRGENL VHQIQYREMN 1100
    SCLNADDLDL MNSSENSHES ADFSAAELIS VSKFLPISGM EKEAILSHTE 1150
    KENGNL 1156
    Length:1,156
    Mass (Da):125,451
    Last modified:November 30, 2010 - v2
    Checksum:i57B49F76DA6C96EB
    GO
    Isoform 2 (identifier: Q86VB7-2) [UniParc]FASTAAdd to Basket

    Also known as: Long tail variant 2

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFS...SHTEKENGNL → GLWVLGGSIA...GSLDAYNGQE

    Show »
    Length:1,161
    Mass (Da):125,982
    Checksum:iDD1C93863FD07979
    GO
    Isoform 3 (identifier: Q86VB7-3) [UniParc]FASTAAdd to Basket

    Also known as: Short tail variant

    The sequence of this isoform differs from the canonical sequence as follows:
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,121
    Mass (Da):121,609
    Checksum:i31279FC947960606
    GO
    Isoform 4 (identifier: Q86VB7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         579-579: R → SKTQKTSLIGSYTVKGTGLGSHSCLFLKPCLLPG
         1115-1156: ENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL → GGHSEPH

    Show »
    Length:1,154
    Mass (Da):124,958
    Checksum:i8814E05FB2EDFE7B
    GO

    Sequence cautioni

    The sequence CAA80541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAA80542.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAA80543.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAA80544.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAB45233.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti342 – 3421I → V.4 Publications
    Corresponds to variant rs4883263 [ dbSNP | Ensembl ].
    VAR_026574

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei579 – 5791R → SKTQKTSLIGSYTVKGTGLG SHSCLFLKPCLLPG in isoform 4. 1 PublicationVSP_019013
    Alternative sequencei1115 – 115642ENSHE…ENGNL → GLWVLGGSIAQGFRSVAAVE AQTFYFDKQLKKSKNVIGSL DAYNGQE in isoform 2. 1 PublicationVSP_019014Add
    BLAST
    Alternative sequencei1115 – 115642ENSHE…ENGNL → GGHSEPH in isoform 3 and isoform 4. 2 PublicationsVSP_019015Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z22968 mRNA. Translation: CAA80541.1. Different initiation.
    Z22969 mRNA. Translation: CAA80542.1. Different initiation.
    Z22970 mRNA. Translation: CAA80543.1. Different initiation.
    Z22971 mRNA. Translation: CAA80544.1. Different initiation.
    Y18388
    , Y18389, Y18390, Y18391, Y18392, Y18393, Y18394, Y18395, Y18396, Y18397, Y18398, Y18399, Y18400, Y18401, Y18402, Y18403 Genomic DNA. Translation: CAB45233.1. Different initiation.
    DQ058615 mRNA. Translation: AAY99762.1.
    AC131206 Genomic DNA. No translation available.
    BC051281 mRNA. Translation: AAH51281.1.
    CCDSiCCDS53742.1. [Q86VB7-3]
    CCDS8578.1. [Q86VB7-1]
    PIRiI38004.
    I38005.
    I38006.
    RefSeqiNP_004235.4. NM_004244.5. [Q86VB7-1]
    NP_981961.2. NM_203416.3. [Q86VB7-3]
    UniGeneiHs.504641.

    Genome annotation databases

    EnsembliENST00000359156; ENSP00000352071; ENSG00000177575. [Q86VB7-1]
    ENST00000432237; ENSP00000403885; ENSG00000177575. [Q86VB7-3]
    GeneIDi9332.
    KEGGihsa:9332.
    UCSCiuc001qsz.3. human. [Q86VB7-1]
    uc001qta.3. human. [Q86VB7-3]

    Polymorphism databases

    DMDMi313104083.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z22968 mRNA. Translation: CAA80541.1 . Different initiation.
    Z22969 mRNA. Translation: CAA80542.1 . Different initiation.
    Z22970 mRNA. Translation: CAA80543.1 . Different initiation.
    Z22971 mRNA. Translation: CAA80544.1 . Different initiation.
    Y18388
    , Y18389 , Y18390 , Y18391 , Y18392 , Y18393 , Y18394 , Y18395 , Y18396 , Y18397 , Y18398 , Y18399 , Y18400 , Y18401 , Y18402 , Y18403 Genomic DNA. Translation: CAB45233.1 . Different initiation.
    DQ058615 mRNA. Translation: AAY99762.1 .
    AC131206 Genomic DNA. No translation available.
    BC051281 mRNA. Translation: AAH51281.1 .
    CCDSi CCDS53742.1. [Q86VB7-3 ]
    CCDS8578.1. [Q86VB7-1 ]
    PIRi I38004.
    I38005.
    I38006.
    RefSeqi NP_004235.4. NM_004244.5. [Q86VB7-1 ]
    NP_981961.2. NM_203416.3. [Q86VB7-3 ]
    UniGenei Hs.504641.

    3D structure databases

    ProteinModelPortali Q86VB7.
    SMRi Q86VB7. Positions 48-264, 277-366, 373-473, 479-683, 714-824, 837-1030.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114741. 2 interactions.
    IntActi Q86VB7. 1 interaction.
    STRINGi 9606.ENSP00000352071.

    PTM databases

    PhosphoSitei Q86VB7.

    Polymorphism databases

    DMDMi 313104083.

    Proteomic databases

    PaxDbi Q86VB7.
    PRIDEi Q86VB7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000359156 ; ENSP00000352071 ; ENSG00000177575 . [Q86VB7-1 ]
    ENST00000432237 ; ENSP00000403885 ; ENSG00000177575 . [Q86VB7-3 ]
    GeneIDi 9332.
    KEGGi hsa:9332.
    UCSCi uc001qsz.3. human. [Q86VB7-1 ]
    uc001qta.3. human. [Q86VB7-3 ]

    Organism-specific databases

    CTDi 9332.
    GeneCardsi GC12M007623.
    HGNCi HGNC:1631. CD163.
    HPAi CAB002432.
    MIMi 605545. gene.
    neXtProti NX_Q86VB7.
    PharmGKBi PA26190.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG83796.
    HOVERGENi HBG080943.
    InParanoidi Q86VB7.
    KOi K06545.
    OMAi SVSCQGH.
    OrthoDBi EOG7RNK07.
    PhylomeDBi Q86VB7.
    TreeFami TF329295.

    Enzyme and pathway databases

    Reactomei REACT_160163. Scavenging of heme from plasma.

    Miscellaneous databases

    ChiTaRSi CD163. human.
    GeneWikii CD163.
    GenomeRNAii 9332.
    NextBioi 34955.
    PROi Q86VB7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q86VB7.
    Bgeei Q86VB7.
    CleanExi HS_CD163.
    Genevestigatori Q86VB7.

    Family and domain databases

    Gene3Di 3.10.250.10. 9 hits.
    InterProi IPR001190. SRCR.
    IPR017448. SRCR-like_dom.
    [Graphical view ]
    Pfami PF00530. SRCR. 9 hits.
    [Graphical view ]
    PRINTSi PR00258. SPERACTRCPTR.
    SMARTi SM00202. SR. 9 hits.
    [Graphical view ]
    SUPFAMi SSF56487. SSF56487. 9 hits.
    PROSITEi PS00420. SRCR_1. 4 hits.
    PS50287. SRCR_2. 9 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily."
      Law S.K.A., Micklem K.J., Shaw J.M., Zhang X.-P., Dong Y., Willis A.C., Mason D.Y.
      Eur. J. Immunol. 23:2320-2325(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT VAL-342.
    2. "Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily."
      Ritter M., Buechler C., Langmann T., Schmitz G.
      Biochem. Biophys. Res. Commun. 260:466-474(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-342.
    3. "Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses."
      Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L.
      Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT VAL-342.
    4. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-342.
      Tissue: Spleen.
    6. "Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family."
      Droste A., Sorg C., Hogger P.
      Biochem. Biophys. Res. Commun. 256:110-113(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: CLEAVAGE.
    7. "Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation."
      Van den Heuvel M.M., Tensen C.P., van As J.H., Van den Berg T.K., Fluitsma D.M., Dijkstra C.D., Dopp E.A., Droste A., Van Gaalen F.A., Sorg C., Hoegger P., Beelen R.H.J.
      J. Leukoc. Biol. 66:858-866(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION.
    8. "Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli."
      Buechler C., Ritter M., Orso E., Langmann T., Klucken J., Schmitz G.
      J. Leukoc. Biol. 67:97-103(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION, SUBCELLULAR LOCATION.
    9. "Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C."
      Ritter M., Buechler C., Kapinsky M., Schmitz G.
      Eur. J. Immunol. 31:999-1009(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF THR-1072 AND SER-1084, INTERACTION WITH CSNK2B.
    10. Cited for: FUNCTION, TISSUE SPECIFICITY, BIOPHYSICOCHEMICAL PROPERTIES, IDENTIFICATION BY MASS SPECTROMETRY.
    11. "Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3."
      Matsushita N., Kashiwagi M., Wait R., Nagayoshi R., Nakamura M., Matsuda T., Hogger P., Guyre P.M., Nagase H., Matsuyama T.
      Clin. Exp. Immunol. 130:156-161(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: CLEAVAGE.
    12. "Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect."
      Frings W., Dreier J., Sorg C.
      FEBS Lett. 526:93-96(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    13. "Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163."
      Hintz K.A., Rassias A.J., Wardwell K., Moss M.L., Morganelli P.M., Pioli P.A., Givan A.L., Wallace P.K., Yeager M.P., Guyre P.M.
      J. Leukoc. Biol. 72:711-717(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: MISCELLANEOUS.
    14. "CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response."
      Moestrup S.K., Moller H.J.
      Ann. Med. 36:347-354(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: RELEVANCE AS DISEASE MARKER IN INFLAMMATORY CONDITIONS.
    15. "Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region."
      Madsen M., Moller H.J., Nielsen M.J., Jacobsen C., Graversen J.H., van den Berg T., Moestrup S.K.
      J. Biol. Chem. 279:51561-51567(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: DOMAIN, CLEAVAGE SITES.
    16. "Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163."
      Sulahian T.H., Pioli P.A., Wardwell K., Guyre P.M.
      J. Leukoc. Biol. 76:271-277(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: CLEAVAGE.
    17. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105.
      Tissue: Plasma.
    18. "The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants."
      Nielsen M.J., Madsen M., Moller H.J., Moestrup S.K.
      J. Leukoc. Biol. 79:837-845(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF TYR-1096, TISSUE SPECIFICITY.
    19. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-105; ASN-140; ASN-767 AND ASN-1027.
      Tissue: Liver.
    20. Cited for: GLYCOSYLATION AT ASN-105.

    Entry informationi

    Entry nameiC163A_HUMAN
    AccessioniPrimary (citable) accession number: Q86VB7
    Secondary accession number(s): C9JIG2
    , Q07898, Q07899, Q07900, Q07901, Q2VLH7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2006
    Last sequence update: November 30, 2010
    Last modified: October 1, 2014
    This is version 102 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Intravenous lipopolysaccharide (LPS) produces a rapid rise of sCD163 in plasma of patient as it induces metalloproteinase-mediated shedding from monocytes surface. Long-term LPS infusion finally increases expression of the membrane-bound form on circulating monocytes.
    The soluble form (sCD163) in plasma is a novel parameter in diseases affecting macrophage function and monocyte/macrophage load in the body. The concentration of sCD163 is probably reflecting the number of macrophages of the 'alternative macrophage activation' phenotype with a high CD163 expression playing a major role in dampening the inflammatory response and scavenging components of damaged cells. This has initiated a number of clinical studies for evaluation of sCD163 as a disease marker in inflammatory conditions e.g. infection, autoimmune disease, transplantation, atherosclerosis and cancer.

    Caution

    It is uncertain whether Met-1 or Met-6 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3