Q86V88 (MGDP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Magnesium-dependent phosphatase 1 Short name=MDP-1 EC=3.1.3.- EC=3.1.3.48 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 176 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Magnesium-dependent phosphatase which may act as a tyrosine phosphatase By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Inhibited by vanadate and zinc, and slightly by calcium By similarity. |
| Sequence similarities | Belongs to the HAD-like hydrolase superfamily. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | peptidyl-tyrosine dephosphorylation Inferred from electronic annotation. Source: GOC |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW protein tyrosine phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86V88-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86V88-2) The sequence of this isoform differs from the canonical sequence as follows: 107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY 128-176: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86V88-3) The sequence of this isoform differs from the canonical sequence as follows: 89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP 123-176: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 176 | 176 | Magnesium-dependent phosphatase 1 | PRO_0000068827 | |||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||
| Active site | 11 | 1 | Nucleophile By similarity | ||||||||||||||||||||||||||||||||||||
| Active site | 13 | 1 | Proton donor By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 11 | 1 | Magnesium By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 13 | 1 | Magnesium By similarity | ||||||||||||||||||||||||||||||||||||
| Metal binding | 123 | 1 | Magnesium By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 12 | 1 | Phosphate; via amide nitrogen By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 13 | 1 | Phosphate; via amide nitrogen By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 20 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 69 | 1 | Phosphate By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 70 | 1 | Phosphate By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 70 | 1 | Substrate By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 100 | 1 | Phosphate By similarity | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 89 – 122 | 34 | YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. | VSP_015985 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 107 – 127 | 21 | LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. | VSP_015986 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 123 – 176 | 54 | Missing in isoform 3. | VSP_015988 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 128 – 176 | 49 | Missing in isoform 2. | VSP_015987 | |||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 6 – 10 | 5 | |||||||||||||||||||||||||||||||||||||
| Turn | 13 – 15 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 16 – 19 | 4 | |||||||||||||||||||||||||||||||||||||
| Turn | 21 – 23 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 51 – 61 | 11 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 65 – 69 | 5 | |||||||||||||||||||||||||||||||||||||
| Helix | 74 – 83 | 10 | |||||||||||||||||||||||||||||||||||||
| Turn | 87 – 89 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 98 | 9 | |||||||||||||||||||||||||||||||||||||
| Helix | 100 – 111 | 12 | |||||||||||||||||||||||||||||||||||||
| Helix | 115 – 117 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 123 | 6 | |||||||||||||||||||||||||||||||||||||
| Helix | 125 – 132 | 8 | |||||||||||||||||||||||||||||||||||||
| Turn | 133 – 135 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 140 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 144 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 147 – 159 | 13 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Small intestine. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain and Liver. |
| [3] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK092821 mRNA. Translation: BAC03984.1. BC046912 mRNA. Translation: AAH46912.1. BC051382 mRNA. Translation: AAH51382.1. | ||||||||||||
| IPI | IPI00337556. IPI00384628. IPI00385758. | ||||||||||||
| RefSeq | NP_001186750.1. NM_001199821.1. NP_612485.2. NM_138476.3. | ||||||||||||
| UniGene | Hs.220963. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q86V88. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| MINT | MINT-1464579. | ||||||||||||
| STRING | 9606.ENSP00000288087. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q86V88. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74727544. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q86V88. | ||||||||||||
| PRIDE | Q86V88. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 145553. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000288087; ENSP00000288087; ENSG00000213920. ENST00000396833; ENSP00000380045; ENSG00000213920. | ||||||||||||
| GeneID | 145553. | ||||||||||||
| KEGG | hsa:145553. | ||||||||||||
| UCSC | uc001wnk.2. human. uc001wnl.2. human. uc001wnm.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 145553. | ||||||||||||
| GeneCards | GC14M024683. | ||||||||||||
| HGNC | HGNC:28781. MDP1. | ||||||||||||
| HPA | HPA003064. | ||||||||||||
| neXtProt | NX_Q86V88. | ||||||||||||
| PharmGKB | PA165479165. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG279690. | ||||||||||||
| HOGENOM | HOG000216653. | ||||||||||||
| HOVERGEN | HBG081971. | ||||||||||||
| InParanoid | Q86V88. | ||||||||||||
| OMA | NGMSLQT. | ||||||||||||
| OrthoDB | EOG432107. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q86V88. | ||||||||||||
| Bgee | Q86V88. | ||||||||||||
| Genevestigator | Q86V88. | ||||||||||||
| GermOnline | ENSG00000100931. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.40.50.1000. 1 hit. | ||||||||||||
| InterPro | IPR023214. HAD-like_dom. IPR010033. HAD_SF_ppase_IIIC. IPR024734. MDP_1_eu. IPR010036. MDP_1_eu_arc. [Graphical view] | ||||||||||||
| PANTHER | PTHR17901. PTHR17901. 1 hit. | ||||||||||||
| Pfam | PF12689. Acid_PPase. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. | ||||||||||||
| TIGRFAMs | TIGR01681. HAD-SF-IIIC. 1 hit. TIGR01685. MDP-1. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q86V88. | ||||||||||||
| GenomeRNAi | 145553. | ||||||||||||
| NextBio | 85134. | ||||||||||||
Entry information
| Entry name | MGDP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86V88 Secondary accession number(s): Q86Y84, Q8NAD9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
