Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86V88

- MGDP1_HUMAN

UniProt

Q86V88 - MGDP1_HUMAN

Protein

Magnesium-dependent phosphatase 1

Gene

MDP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 1 (01 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.By similarity

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

    Cofactori

    Magnesium.By similarity

    Enzyme regulationi

    Inhibited by vanadate and zinc, and slightly by calcium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei11 – 111NucleophileBy similarity
    Metal bindingi11 – 111MagnesiumBy similarity
    Binding sitei12 – 121Phosphate; via amide nitrogenBy similarity
    Active sitei13 – 131Proton donorBy similarity
    Metal bindingi13 – 131MagnesiumBy similarity
    Binding sitei13 – 131Phosphate; via amide nitrogenBy similarity
    Binding sitei20 – 201SubstrateBy similarity
    Binding sitei69 – 691PhosphateBy similarity
    Binding sitei70 – 701PhosphateBy similarity
    Binding sitei70 – 701SubstrateBy similarity
    Binding sitei100 – 1001PhosphateBy similarity
    Metal bindingi123 – 1231MagnesiumBy similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. protein tyrosine phosphatase activity Source: UniProtKB-EC

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Magnesium, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Magnesium-dependent phosphatase 1 (EC:3.1.3.-, EC:3.1.3.48)
    Short name:
    MDP-1
    Gene namesi
    Name:MDP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:28781. MDP1.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165479165.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 176176Magnesium-dependent phosphatase 1PRO_0000068827Add
    BLAST

    Proteomic databases

    MaxQBiQ86V88.
    PaxDbiQ86V88.
    PRIDEiQ86V88.

    PTM databases

    PhosphoSiteiQ86V88.

    Expressioni

    Gene expression databases

    BgeeiQ86V88.
    GenevestigatoriQ86V88.

    Organism-specific databases

    HPAiHPA003064.

    Interactioni

    Protein-protein interaction databases

    BioGridi126921. 2 interactions.
    MINTiMINT-1464579.
    STRINGi9606.ENSP00000288087.

    Structurei

    Secondary structure

    1
    176
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi6 – 105
    Turni13 – 153
    Beta strandi16 – 194
    Turni21 – 233
    Helixi51 – 6111
    Beta strandi65 – 695
    Helixi74 – 8310
    Turni87 – 893
    Beta strandi90 – 989
    Helixi100 – 11112
    Helixi115 – 1173
    Beta strandi118 – 1236
    Helixi125 – 1328
    Turni133 – 1353
    Beta strandi137 – 1404
    Beta strandi142 – 1443
    Helixi147 – 15913

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2WM8X-ray1.75A1-165[»]
    ProteinModelPortaliQ86V88.
    SMRiQ86V88. Positions 1-161.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ86V88.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the HAD-like hydrolase superfamily.Curated

    Phylogenomic databases

    eggNOGiNOG279690.
    HOGENOMiHOG000216653.
    HOVERGENiHBG081971.
    InParanoidiQ86V88.
    KOiK17619.
    OMAiHVQNGMS.
    OrthoDBiEOG7PK913.
    PhylomeDBiQ86V88.
    TreeFamiTF328413.

    Family and domain databases

    Gene3Di3.40.50.1000. 1 hit.
    InterProiIPR023214. HAD-like_dom.
    IPR010033. HAD_SF_ppase_IIIC.
    IPR024734. MDP_1_eu.
    IPR010036. MDP_1_eu_arc.
    [Graphical view]
    PANTHERiPTHR17901. PTHR17901. 1 hit.
    PfamiPF12689. Acid_PPase. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    TIGRFAMsiTIGR01681. HAD-SF-IIIC. 1 hit.
    TIGR01685. MDP-1. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86V88-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE    50
    VPEVLKRLQS LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK 100
    ITHFERLQQK TGIPFSQMIF FDDERRNIVD VSKLGVTCIH IQNGMNLQTL 150
    SQGLETFAKA QTGPLRSSLE ESPFEA 176
    Length:176
    Mass (Da):20,109
    Last modified:June 1, 2003 - v1
    Checksum:iB0A33BD02458B2EF
    GO
    Isoform 2 (identifier: Q86V88-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
         128-176: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:127
    Mass (Da):14,818
    Checksum:i3203C1FE34BB9CA2
    GO
    Isoform 3 (identifier: Q86V88-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
         123-176: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:122
    Mass (Da):14,038
    Checksum:iB016158C63765443
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei89 – 12234YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. 1 PublicationVSP_015985Add
    BLAST
    Alternative sequencei107 – 12721LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. 1 PublicationVSP_015986Add
    BLAST
    Alternative sequencei123 – 17654Missing in isoform 3. 1 PublicationVSP_015988Add
    BLAST
    Alternative sequencei128 – 17649Missing in isoform 2. 1 PublicationVSP_015987Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK092821 mRNA. Translation: BAC03984.1.
    BC046912 mRNA. Translation: AAH46912.1.
    BC051382 mRNA. Translation: AAH51382.1.
    CCDSiCCDS55908.1. [Q86V88-3]
    CCDS9620.1. [Q86V88-1]
    RefSeqiNP_001186750.1. NM_001199821.1. [Q86V88-3]
    NP_612485.2. NM_138476.3. [Q86V88-1]
    UniGeneiHs.220963.

    Genome annotation databases

    EnsembliENST00000288087; ENSP00000288087; ENSG00000213920. [Q86V88-1]
    ENST00000396833; ENSP00000380045; ENSG00000213920. [Q86V88-3]
    GeneIDi145553.
    KEGGihsa:145553.
    UCSCiuc001wnk.2. human. [Q86V88-2]
    uc001wnl.2. human. [Q86V88-1]
    uc001wnm.2. human. [Q86V88-3]

    Polymorphism databases

    DMDMi74727544.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK092821 mRNA. Translation: BAC03984.1 .
    BC046912 mRNA. Translation: AAH46912.1 .
    BC051382 mRNA. Translation: AAH51382.1 .
    CCDSi CCDS55908.1. [Q86V88-3 ]
    CCDS9620.1. [Q86V88-1 ]
    RefSeqi NP_001186750.1. NM_001199821.1. [Q86V88-3 ]
    NP_612485.2. NM_138476.3. [Q86V88-1 ]
    UniGenei Hs.220963.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2WM8 X-ray 1.75 A 1-165 [» ]
    ProteinModelPortali Q86V88.
    SMRi Q86V88. Positions 1-161.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126921. 2 interactions.
    MINTi MINT-1464579.
    STRINGi 9606.ENSP00000288087.

    PTM databases

    PhosphoSitei Q86V88.

    Polymorphism databases

    DMDMi 74727544.

    Proteomic databases

    MaxQBi Q86V88.
    PaxDbi Q86V88.
    PRIDEi Q86V88.

    Protocols and materials databases

    DNASUi 145553.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000288087 ; ENSP00000288087 ; ENSG00000213920 . [Q86V88-1 ]
    ENST00000396833 ; ENSP00000380045 ; ENSG00000213920 . [Q86V88-3 ]
    GeneIDi 145553.
    KEGGi hsa:145553.
    UCSCi uc001wnk.2. human. [Q86V88-2 ]
    uc001wnl.2. human. [Q86V88-1 ]
    uc001wnm.2. human. [Q86V88-3 ]

    Organism-specific databases

    CTDi 145553.
    GeneCardsi GC14M024683.
    HGNCi HGNC:28781. MDP1.
    HPAi HPA003064.
    neXtProti NX_Q86V88.
    PharmGKBi PA165479165.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG279690.
    HOGENOMi HOG000216653.
    HOVERGENi HBG081971.
    InParanoidi Q86V88.
    KOi K17619.
    OMAi HVQNGMS.
    OrthoDBi EOG7PK913.
    PhylomeDBi Q86V88.
    TreeFami TF328413.

    Miscellaneous databases

    EvolutionaryTracei Q86V88.
    GenomeRNAii 145553.
    NextBioi 85134.
    PROi Q86V88.

    Gene expression databases

    Bgeei Q86V88.
    Genevestigatori Q86V88.

    Family and domain databases

    Gene3Di 3.40.50.1000. 1 hit.
    InterProi IPR023214. HAD-like_dom.
    IPR010033. HAD_SF_ppase_IIIC.
    IPR024734. MDP_1_eu.
    IPR010036. MDP_1_eu_arc.
    [Graphical view ]
    PANTHERi PTHR17901. PTHR17901. 1 hit.
    Pfami PF12689. Acid_PPase. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    TIGRFAMsi TIGR01681. HAD-SF-IIIC. 1 hit.
    TIGR01685. MDP-1. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Small intestine.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain and Liver.
    3. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiMGDP1_HUMAN
    AccessioniPrimary (citable) accession number: Q86V88
    Secondary accession number(s): Q86Y84, Q8NAD9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 25, 2005
    Last sequence update: June 1, 2003
    Last modified: October 1, 2014
    This is version 98 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3