Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q86V88 (MGDP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Magnesium-dependent phosphatase 1

Short name=MDP-1
EC=3.1.3.-
EC=3.1.3.48
Gene names
Name:MDP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length176 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Magnesium-dependent phosphatase which may act as a tyrosine phosphatase By similarity.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Cofactor

Magnesium By similarity.

Enzyme regulation

Inhibited by vanadate and zinc, and slightly by calcium By similarity.

Sequence similarities

Belongs to the HAD-like hydrolase superfamily.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   LigandMagnesium
Metal-binding
   Molecular functionHydrolase
Protein phosphatase
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

protein tyrosine phosphatase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q86V88-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q86V88-2)

The sequence of this isoform differs from the canonical sequence as follows:
     107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
     128-176: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q86V88-3)

The sequence of this isoform differs from the canonical sequence as follows:
     89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
     123-176: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 176176Magnesium-dependent phosphatase 1
PRO_0000068827

Sites

Active site111Nucleophile By similarity
Active site131Proton donor By similarity
Metal binding111Magnesium By similarity
Metal binding131Magnesium By similarity
Metal binding1231Magnesium By similarity
Binding site121Phosphate; via amide nitrogen By similarity
Binding site131Phosphate; via amide nitrogen By similarity
Binding site201Substrate By similarity
Binding site691Phosphate By similarity
Binding site701Phosphate By similarity
Binding site701Substrate By similarity
Binding site1001Phosphate By similarity

Natural variations

Alternative sequence89 – 12234YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3.
VSP_015985
Alternative sequence107 – 12721LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2.
VSP_015986
Alternative sequence123 – 17654Missing in isoform 3.
VSP_015988
Alternative sequence128 – 17649Missing in isoform 2.
VSP_015987

Secondary structure

............................... 176
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2003. Version 1.
Checksum: B0A33BD02458B2EF

FASTA17620,109
        10         20         30         40         50         60 
MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE VPEVLKRLQS 

        70         80         90        100        110        120 
LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK ITHFERLQQK TGIPFSQMIF 

       130        140        150        160        170 
FDDERRNIVD VSKLGVTCIH IQNGMNLQTL SQGLETFAKA QTGPLRSSLE ESPFEA 

« Hide

Isoform 2 [UniParc].

Checksum: 3203C1FE34BB9CA2
Show »

FASTA12714,818
Isoform 3 [UniParc].

Checksum: B016158C63765443
Show »

FASTA12214,038

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Small intestine.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Brain and Liver.
[3]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK092821 mRNA. Translation: BAC03984.1.
BC046912 mRNA. Translation: AAH46912.1.
BC051382 mRNA. Translation: AAH51382.1.
RefSeqNP_001186750.1. NM_001199821.1.
NP_612485.2. NM_138476.3.
UniGeneHs.220963.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortalQ86V88.
SMRQ86V88. Positions 1-161.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126921. 2 interactions.
MINTMINT-1464579.
STRING9606.ENSP00000288087.

PTM databases

PhosphoSiteQ86V88.

Polymorphism databases

DMDM74727544.

Proteomic databases

PaxDbQ86V88.
PRIDEQ86V88.

Protocols and materials databases

DNASU145553.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000288087; ENSP00000288087; ENSG00000213920. [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920. [Q86V88-3]
GeneID145553.
KEGGhsa:145553.
UCSCuc001wnk.2. human. [Q86V88-2]
uc001wnl.2. human. [Q86V88-1]
uc001wnm.2. human. [Q86V88-3]

Organism-specific databases

CTD145553.
GeneCardsGC14M024683.
HGNCHGNC:28781. MDP1.
HPAHPA003064.
neXtProtNX_Q86V88.
PharmGKBPA165479165.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG279690.
HOGENOMHOG000216653.
HOVERGENHBG081971.
InParanoidQ86V88.
KOK17619.
OMAHVQNGMS.
OrthoDBEOG7PK913.
PhylomeDBQ86V88.
TreeFamTF328413.

Gene expression databases

BgeeQ86V88.
GenevestigatorQ86V88.

Family and domain databases

Gene3D3.40.50.1000. 1 hit.
InterProIPR023214. HAD-like_dom.
IPR010033. HAD_SF_ppase_IIIC.
IPR024734. MDP_1_eu.
IPR010036. MDP_1_eu_arc.
[Graphical view]
PANTHERPTHR17901. PTHR17901. 1 hit.
PfamPF12689. Acid_PPase. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 1 hit.
TIGRFAMsTIGR01681. HAD-SF-IIIC. 1 hit.
TIGR01685. MDP-1. 1 hit.
ProtoNetSearch...

Other

EvolutionaryTraceQ86V88.
GenomeRNAi145553.
NextBio85134.
PROQ86V88.

Entry information

Entry nameMGDP1_HUMAN
AccessionPrimary (citable) accession number: Q86V88
Secondary accession number(s): Q86Y84, Q8NAD9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: June 1, 2003
Last modified: April 16, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM