Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86V88

- MGDP1_HUMAN

UniProt

Q86V88 - MGDP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Magnesium-dependent phosphatase 1

Gene

MDP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Cofactori

Mg2+By similarity

Enzyme regulationi

Inhibited by vanadate and zinc, and slightly by calcium.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei11 – 111NucleophileBy similarity
Metal bindingi11 – 111MagnesiumBy similarity
Binding sitei12 – 121Phosphate; via amide nitrogenBy similarity
Active sitei13 – 131Proton donorBy similarity
Metal bindingi13 – 131MagnesiumBy similarity
Binding sitei13 – 131Phosphate; via amide nitrogenBy similarity
Binding sitei20 – 201SubstrateBy similarity
Binding sitei69 – 691PhosphateBy similarity
Binding sitei70 – 701PhosphateBy similarity
Binding sitei70 – 701SubstrateBy similarity
Binding sitei100 – 1001PhosphateBy similarity
Metal bindingi123 – 1231MagnesiumBy similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. protein tyrosine phosphatase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Magnesium-dependent phosphatase 1 (EC:3.1.3.-, EC:3.1.3.48)
Short name:
MDP-1
Gene namesi
Name:MDP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:28781. MDP1.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165479165.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 176176Magnesium-dependent phosphatase 1PRO_0000068827Add
BLAST

Proteomic databases

MaxQBiQ86V88.
PaxDbiQ86V88.
PRIDEiQ86V88.

PTM databases

PhosphoSiteiQ86V88.

Expressioni

Gene expression databases

BgeeiQ86V88.
GenevestigatoriQ86V88.

Organism-specific databases

HPAiHPA003064.

Interactioni

Protein-protein interaction databases

BioGridi126921. 2 interactions.
MINTiMINT-1464579.
STRINGi9606.ENSP00000288087.

Structurei

Secondary structure

1
176
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi6 – 105Combined sources
Turni13 – 153Combined sources
Beta strandi16 – 194Combined sources
Turni21 – 233Combined sources
Helixi51 – 6111Combined sources
Beta strandi65 – 695Combined sources
Helixi74 – 8310Combined sources
Turni87 – 893Combined sources
Beta strandi90 – 989Combined sources
Helixi100 – 11112Combined sources
Helixi115 – 1173Combined sources
Beta strandi118 – 1236Combined sources
Helixi125 – 1328Combined sources
Turni133 – 1353Combined sources
Beta strandi137 – 1404Combined sources
Beta strandi142 – 1443Combined sources
Helixi147 – 15913Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortaliQ86V88.
SMRiQ86V88. Positions 1-161.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ86V88.

Family & Domainsi

Sequence similaritiesi

Belongs to the HAD-like hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiNOG279690.
GeneTreeiENSGT00390000004110.
HOGENOMiHOG000216653.
HOVERGENiHBG081971.
InParanoidiQ86V88.
KOiK17619.
OMAiHVQNGMS.
OrthoDBiEOG7PK913.
PhylomeDBiQ86V88.
TreeFamiTF328413.

Family and domain databases

Gene3Di3.40.50.1000. 1 hit.
InterProiIPR023214. HAD-like_dom.
IPR010033. HAD_SF_ppase_IIIC.
IPR024734. MDP_1_eu.
IPR010036. MDP_1_eu_arc.
[Graphical view]
PANTHERiPTHR17901. PTHR17901. 1 hit.
PfamiPF12689. Acid_PPase. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01681. HAD-SF-IIIC. 1 hit.
TIGR01685. MDP-1. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86V88-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE
60 70 80 90 100
VPEVLKRLQS LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK
110 120 130 140 150
ITHFERLQQK TGIPFSQMIF FDDERRNIVD VSKLGVTCIH IQNGMNLQTL
160 170
SQGLETFAKA QTGPLRSSLE ESPFEA
Length:176
Mass (Da):20,109
Last modified:June 1, 2003 - v1
Checksum:iB0A33BD02458B2EF
GO
Isoform 2 (identifier: Q86V88-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
     128-176: Missing.

Note: No experimental confirmation available.

Show »
Length:127
Mass (Da):14,818
Checksum:i3203C1FE34BB9CA2
GO
Isoform 3 (identifier: Q86V88-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
     123-176: Missing.

Note: No experimental confirmation available.

Show »
Length:122
Mass (Da):14,038
Checksum:iB016158C63765443
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei89 – 12234YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. 1 PublicationVSP_015985Add
BLAST
Alternative sequencei107 – 12721LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. 1 PublicationVSP_015986Add
BLAST
Alternative sequencei123 – 17654Missing in isoform 3. 1 PublicationVSP_015988Add
BLAST
Alternative sequencei128 – 17649Missing in isoform 2. 1 PublicationVSP_015987Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA. Translation: BAC03984.1.
BC046912 mRNA. Translation: AAH46912.1.
BC051382 mRNA. Translation: AAH51382.1.
CCDSiCCDS55908.1. [Q86V88-3]
CCDS9620.1. [Q86V88-1]
RefSeqiNP_001186750.1. NM_001199821.1. [Q86V88-3]
NP_612485.2. NM_138476.3. [Q86V88-1]
UniGeneiHs.220963.

Genome annotation databases

EnsembliENST00000288087; ENSP00000288087; ENSG00000213920. [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920. [Q86V88-3]
GeneIDi145553.
KEGGihsa:145553.
UCSCiuc001wnk.2. human. [Q86V88-2]
uc001wnl.2. human. [Q86V88-1]
uc001wnm.2. human. [Q86V88-3]

Polymorphism databases

DMDMi74727544.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA. Translation: BAC03984.1 .
BC046912 mRNA. Translation: AAH46912.1 .
BC051382 mRNA. Translation: AAH51382.1 .
CCDSi CCDS55908.1. [Q86V88-3 ]
CCDS9620.1. [Q86V88-1 ]
RefSeqi NP_001186750.1. NM_001199821.1. [Q86V88-3 ]
NP_612485.2. NM_138476.3. [Q86V88-1 ]
UniGenei Hs.220963.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2WM8 X-ray 1.75 A 1-165 [» ]
ProteinModelPortali Q86V88.
SMRi Q86V88. Positions 1-161.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126921. 2 interactions.
MINTi MINT-1464579.
STRINGi 9606.ENSP00000288087.

PTM databases

PhosphoSitei Q86V88.

Polymorphism databases

DMDMi 74727544.

Proteomic databases

MaxQBi Q86V88.
PaxDbi Q86V88.
PRIDEi Q86V88.

Protocols and materials databases

DNASUi 145553.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000288087 ; ENSP00000288087 ; ENSG00000213920 . [Q86V88-1 ]
ENST00000396833 ; ENSP00000380045 ; ENSG00000213920 . [Q86V88-3 ]
GeneIDi 145553.
KEGGi hsa:145553.
UCSCi uc001wnk.2. human. [Q86V88-2 ]
uc001wnl.2. human. [Q86V88-1 ]
uc001wnm.2. human. [Q86V88-3 ]

Organism-specific databases

CTDi 145553.
GeneCardsi GC14M024683.
HGNCi HGNC:28781. MDP1.
HPAi HPA003064.
neXtProti NX_Q86V88.
PharmGKBi PA165479165.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG279690.
GeneTreei ENSGT00390000004110.
HOGENOMi HOG000216653.
HOVERGENi HBG081971.
InParanoidi Q86V88.
KOi K17619.
OMAi HVQNGMS.
OrthoDBi EOG7PK913.
PhylomeDBi Q86V88.
TreeFami TF328413.

Miscellaneous databases

EvolutionaryTracei Q86V88.
GenomeRNAii 145553.
NextBioi 85134.
PROi Q86V88.

Gene expression databases

Bgeei Q86V88.
Genevestigatori Q86V88.

Family and domain databases

Gene3Di 3.40.50.1000. 1 hit.
InterProi IPR023214. HAD-like_dom.
IPR010033. HAD_SF_ppase_IIIC.
IPR024734. MDP_1_eu.
IPR010036. MDP_1_eu_arc.
[Graphical view ]
PANTHERi PTHR17901. PTHR17901. 1 hit.
Pfami PF12689. Acid_PPase. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
TIGRFAMsi TIGR01681. HAD-SF-IIIC. 1 hit.
TIGR01685. MDP-1. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Small intestine.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain and Liver.
  3. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiMGDP1_HUMAN
AccessioniPrimary (citable) accession number: Q86V88
Secondary accession number(s): Q86Y84, Q8NAD9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: June 1, 2003
Last modified: November 26, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3