Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Magnesium-dependent phosphatase 1

Gene

MDP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Cofactori

Mg2+By similarity

Enzyme regulationi

Inhibited by vanadate and zinc, and slightly by calcium.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei11NucleophileBy similarity1
Metal bindingi11MagnesiumBy similarity1
Binding sitei12Phosphate; via amide nitrogenBy similarity1
Active sitei13Proton donorBy similarity1
Metal bindingi13MagnesiumBy similarity1
Binding sitei13Phosphate; via amide nitrogenBy similarity1
Binding sitei20SubstrateBy similarity1
Binding sitei69PhosphateBy similarity1
Binding sitei70PhosphateBy similarity1
Binding sitei70SubstrateBy similarity1
Binding sitei100PhosphateBy similarity1
Metal bindingi123MagnesiumBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMagnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Magnesium-dependent phosphatase 1 (EC:3.1.3.-, EC:3.1.3.48)
Short name:
MDP-1
Gene namesi
Name:MDP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000213920.8
HGNCiHGNC:28781 MDP1
neXtProtiNX_Q86V88

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000213920
PharmGKBiPA165479165

Polymorphism and mutation databases

BioMutaiMDP1
DMDMi74727544

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688271 – 176Magnesium-dependent phosphatase 1Add BLAST176

Proteomic databases

EPDiQ86V88
MaxQBiQ86V88
PaxDbiQ86V88
PeptideAtlasiQ86V88
PRIDEiQ86V88

PTM databases

DEPODiQ86V88
iPTMnetiQ86V88
PhosphoSitePlusiQ86V88

Expressioni

Gene expression databases

BgeeiENSG00000213920
GenevisibleiQ86V88 HS

Organism-specific databases

HPAiHPA003064
HPA070338

Interactioni

Protein-protein interaction databases

BioGridi126921, 2 interactors
STRINGi9606.ENSP00000288087

Structurei

Secondary structure

1176
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 10Combined sources5
Turni13 – 15Combined sources3
Beta strandi16 – 19Combined sources4
Turni21 – 23Combined sources3
Helixi51 – 61Combined sources11
Beta strandi65 – 69Combined sources5
Helixi74 – 83Combined sources10
Turni87 – 89Combined sources3
Beta strandi90 – 98Combined sources9
Helixi100 – 111Combined sources12
Helixi115 – 117Combined sources3
Beta strandi118 – 123Combined sources6
Helixi125 – 132Combined sources8
Turni133 – 135Combined sources3
Beta strandi137 – 140Combined sources4
Beta strandi142 – 144Combined sources3
Helixi147 – 159Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortaliQ86V88
SMRiQ86V88
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ86V88

Family & Domainsi

Sequence similaritiesi

Belongs to the HAD-like hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiKOG4549 Eukaryota
ENOG4111PHW LUCA
GeneTreeiENSGT00390000004110
HOGENOMiHOG000216653
HOVERGENiHBG081971
InParanoidiQ86V88
KOiK17619
OMAiRGVWAWR
OrthoDBiEOG091G0SQ5
PhylomeDBiQ86V88
TreeFamiTF328413

Family and domain databases

CDDicd07501 HAD_MDP-1_like, 1 hit
Gene3Di3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR010033 HAD_SF_ppase_IIIC
IPR035679 MDP-1_euk
IPR010036 MDP_1_eu_arc
PANTHERiPTHR17901 PTHR17901, 1 hit
PfamiView protein in Pfam
PF12689 Acid_PPase, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR01681 HAD-SF-IIIC, 1 hit
TIGR01685 MDP-1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86V88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE
60 70 80 90 100
VPEVLKRLQS LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK
110 120 130 140 150
ITHFERLQQK TGIPFSQMIF FDDERRNIVD VSKLGVTCIH IQNGMNLQTL
160 170
SQGLETFAKA QTGPLRSSLE ESPFEA
Length:176
Mass (Da):20,109
Last modified:June 1, 2003 - v1
Checksum:iB0A33BD02458B2EF
GO
Isoform 2 (identifier: Q86V88-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
     128-176: Missing.

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):14,818
Checksum:i3203C1FE34BB9CA2
GO
Isoform 3 (identifier: Q86V88-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
     123-176: Missing.

Note: No experimental confirmation available.
Show »
Length:122
Mass (Da):14,038
Checksum:iB016158C63765443
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01598589 – 122YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_015986107 – 127LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_015988123 – 176Missing in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_015987128 – 176Missing in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA Translation: BAC03984.1
BC046912 mRNA Translation: AAH46912.1
BC051382 mRNA Translation: AAH51382.1
CCDSiCCDS55908.1 [Q86V88-3]
CCDS9620.1 [Q86V88-1]
RefSeqiNP_001186750.1, NM_001199821.1 [Q86V88-3]
NP_612485.2, NM_138476.3 [Q86V88-1]
UniGeneiHs.220963

Genome annotation databases

EnsembliENST00000288087; ENSP00000288087; ENSG00000213920 [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920 [Q86V88-3]
GeneIDi145553
KEGGihsa:145553
UCSCiuc001wnl.3 human [Q86V88-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMGDP1_HUMAN
AccessioniPrimary (citable) accession number: Q86V88
Secondary accession number(s): Q86Y84, Q8NAD9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: June 1, 2003
Last modified: February 28, 2018
This is version 123 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health