Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Magnesium-dependent phosphatase 1

Gene

MDP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Cofactori

Mg2+By similarity

Enzyme regulationi

Inhibited by vanadate and zinc, and slightly by calcium.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei11NucleophileBy similarity1
Metal bindingi11MagnesiumBy similarity1
Binding sitei12Phosphate; via amide nitrogenBy similarity1
Active sitei13Proton donorBy similarity1
Metal bindingi13MagnesiumBy similarity1
Binding sitei13Phosphate; via amide nitrogenBy similarity1
Binding sitei20SubstrateBy similarity1
Binding sitei69PhosphateBy similarity1
Binding sitei70PhosphateBy similarity1
Binding sitei70SubstrateBy similarity1
Binding sitei100PhosphateBy similarity1
Metal bindingi123MagnesiumBy similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Magnesium-dependent phosphatase 1 (EC:3.1.3.-, EC:3.1.3.48)
Short name:
MDP-1
Gene namesi
Name:MDP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:28781. MDP1.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000213920.
PharmGKBiPA165479165.

Polymorphism and mutation databases

BioMutaiMDP1.
DMDMi74727544.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688271 – 176Magnesium-dependent phosphatase 1Add BLAST176

Proteomic databases

EPDiQ86V88.
MaxQBiQ86V88.
PaxDbiQ86V88.
PeptideAtlasiQ86V88.
PRIDEiQ86V88.

PTM databases

DEPODiQ86V88.
iPTMnetiQ86V88.
PhosphoSitePlusiQ86V88.

Expressioni

Gene expression databases

BgeeiENSG00000213920.
GenevisibleiQ86V88. HS.

Organism-specific databases

HPAiHPA003064.

Interactioni

Protein-protein interaction databases

BioGridi126921. 2 interactors.
MINTiMINT-1464579.
STRINGi9606.ENSP00000288087.

Structurei

Secondary structure

1176
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 10Combined sources5
Turni13 – 15Combined sources3
Beta strandi16 – 19Combined sources4
Turni21 – 23Combined sources3
Helixi51 – 61Combined sources11
Beta strandi65 – 69Combined sources5
Helixi74 – 83Combined sources10
Turni87 – 89Combined sources3
Beta strandi90 – 98Combined sources9
Helixi100 – 111Combined sources12
Helixi115 – 117Combined sources3
Beta strandi118 – 123Combined sources6
Helixi125 – 132Combined sources8
Turni133 – 135Combined sources3
Beta strandi137 – 140Combined sources4
Beta strandi142 – 144Combined sources3
Helixi147 – 159Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortaliQ86V88.
SMRiQ86V88.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ86V88.

Family & Domainsi

Sequence similaritiesi

Belongs to the HAD-like hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiKOG4549. Eukaryota.
ENOG4111PHW. LUCA.
GeneTreeiENSGT00390000004110.
HOGENOMiHOG000216653.
HOVERGENiHBG081971.
InParanoidiQ86V88.
KOiK17619.
OMAiHVQNGMS.
OrthoDBiEOG091G0SQ5.
PhylomeDBiQ86V88.
TreeFamiTF328413.

Family and domain databases

Gene3Di3.40.50.1000. 1 hit.
InterProiIPR023214. HAD-like_dom.
IPR010033. HAD_SF_ppase_IIIC.
IPR024734. MDP_1_eu.
IPR010036. MDP_1_eu_arc.
[Graphical view]
PANTHERiPTHR17901. PTHR17901. 1 hit.
PfamiPF12689. Acid_PPase. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01681. HAD-SF-IIIC. 1 hit.
TIGR01685. MDP-1. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86V88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARLPKLAVF DLDYTLWPFW VDTHVDPPFH KSSDGTVRDR RGQDVRLYPE
60 70 80 90 100
VPEVLKRLQS LGVPGAAASR TSEIEGANQL LELFDLFRYF VHREIYPGSK
110 120 130 140 150
ITHFERLQQK TGIPFSQMIF FDDERRNIVD VSKLGVTCIH IQNGMNLQTL
160 170
SQGLETFAKA QTGPLRSSLE ESPFEA
Length:176
Mass (Da):20,109
Last modified:June 1, 2003 - v1
Checksum:iB0A33BD02458B2EF
GO
Isoform 2 (identifier: Q86V88-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-127: LQQKTGIPFSQMIFFDDERRN → YAEIREEQGEKVSERPGKPRY
     128-176: Missing.

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):14,818
Checksum:i3203C1FE34BB9CA2
GO
Isoform 3 (identifier: Q86V88-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-122: YFVHREIYPGSKITHFERLQQKTGIPFSQMIFFD → CYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP
     123-176: Missing.

Note: No experimental confirmation available.
Show »
Length:122
Mass (Da):14,038
Checksum:iB016158C63765443
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01598589 – 122YFVHR…MIFFD → CYLHSHPEWNESSNSKSRVR DICEGPNWAFEVQP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_015986107 – 127LQQKT…DERRN → YAEIREEQGEKVSERPGKPR Y in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_015988123 – 176Missing in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_015987128 – 176Missing in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA. Translation: BAC03984.1.
BC046912 mRNA. Translation: AAH46912.1.
BC051382 mRNA. Translation: AAH51382.1.
CCDSiCCDS55908.1. [Q86V88-3]
CCDS9620.1. [Q86V88-1]
RefSeqiNP_001186750.1. NM_001199821.1. [Q86V88-3]
NP_612485.2. NM_138476.3. [Q86V88-1]
UniGeneiHs.220963.

Genome annotation databases

EnsembliENST00000288087; ENSP00000288087; ENSG00000213920. [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920. [Q86V88-3]
GeneIDi145553.
KEGGihsa:145553.
UCSCiuc001wnl.3. human. [Q86V88-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092821 mRNA. Translation: BAC03984.1.
BC046912 mRNA. Translation: AAH46912.1.
BC051382 mRNA. Translation: AAH51382.1.
CCDSiCCDS55908.1. [Q86V88-3]
CCDS9620.1. [Q86V88-1]
RefSeqiNP_001186750.1. NM_001199821.1. [Q86V88-3]
NP_612485.2. NM_138476.3. [Q86V88-1]
UniGeneiHs.220963.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WM8X-ray1.75A1-165[»]
ProteinModelPortaliQ86V88.
SMRiQ86V88.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126921. 2 interactors.
MINTiMINT-1464579.
STRINGi9606.ENSP00000288087.

PTM databases

DEPODiQ86V88.
iPTMnetiQ86V88.
PhosphoSitePlusiQ86V88.

Polymorphism and mutation databases

BioMutaiMDP1.
DMDMi74727544.

Proteomic databases

EPDiQ86V88.
MaxQBiQ86V88.
PaxDbiQ86V88.
PeptideAtlasiQ86V88.
PRIDEiQ86V88.

Protocols and materials databases

DNASUi145553.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288087; ENSP00000288087; ENSG00000213920. [Q86V88-1]
ENST00000396833; ENSP00000380045; ENSG00000213920. [Q86V88-3]
GeneIDi145553.
KEGGihsa:145553.
UCSCiuc001wnl.3. human. [Q86V88-1]

Organism-specific databases

CTDi145553.
GeneCardsiMDP1.
HGNCiHGNC:28781. MDP1.
HPAiHPA003064.
neXtProtiNX_Q86V88.
OpenTargetsiENSG00000213920.
PharmGKBiPA165479165.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4549. Eukaryota.
ENOG4111PHW. LUCA.
GeneTreeiENSGT00390000004110.
HOGENOMiHOG000216653.
HOVERGENiHBG081971.
InParanoidiQ86V88.
KOiK17619.
OMAiHVQNGMS.
OrthoDBiEOG091G0SQ5.
PhylomeDBiQ86V88.
TreeFamiTF328413.

Miscellaneous databases

EvolutionaryTraceiQ86V88.
GenomeRNAii145553.
PROiQ86V88.

Gene expression databases

BgeeiENSG00000213920.
GenevisibleiQ86V88. HS.

Family and domain databases

Gene3Di3.40.50.1000. 1 hit.
InterProiIPR023214. HAD-like_dom.
IPR010033. HAD_SF_ppase_IIIC.
IPR024734. MDP_1_eu.
IPR010036. MDP_1_eu_arc.
[Graphical view]
PANTHERiPTHR17901. PTHR17901. 1 hit.
PfamiPF12689. Acid_PPase. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
TIGRFAMsiTIGR01681. HAD-SF-IIIC. 1 hit.
TIGR01685. MDP-1. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMGDP1_HUMAN
AccessioniPrimary (citable) accession number: Q86V88
Secondary accession number(s): Q86Y84, Q8NAD9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.