Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vasohibin-2

Gene

VASH2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Angiogenesis inhibitor. Inhibits network formation by endothelial cells.1 Publication

GO - Biological processi

  • positive regulation of angiogenesis Source: MGI
  • positive regulation of endothelial cell proliferation Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Vasohibin-2
Alternative name(s):
Vasohibin-like protein
Gene namesi
Name:VASH2
Synonyms:VASHL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25723. VASH2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145147736.

Polymorphism and mutation databases

BioMutaiVASH2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 355355Vasohibin-2PRO_0000189982Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei302 – 3021PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ86V25.

PTM databases

iPTMnetiQ86V25.
PhosphoSiteiQ86V25.

Expressioni

Developmental stagei

Expressed in various embryonic organs at 6 to 12 embryonic weeks. Detected in vessels from 20-week embryonic organs as well as in endothelial cells from large vessels in neonate.1 Publication

Inductioni

By VEGF.1 Publication

Gene expression databases

BgeeiQ86V25.
CleanExiHS_VASH2.
ExpressionAtlasiQ86V25. baseline and differential.
GenevisibleiQ86V25. HS.

Organism-specific databases

HPAiHPA045820.

Interactioni

Subunit structurei

Interacts with SVBP; the interaction enhances VASH2 secretion.1 Publication

Protein-protein interaction databases

BioGridi122902. 2 interactions.
IntActiQ86V25. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ86V25.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the vasohibin family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000012703.
HOGENOMiHOG000007477.
HOVERGENiHBG079337.
InParanoidiQ86V25.
OMAiMLQYNHT.
OrthoDBiEOG7DC24N.
PhylomeDBiQ86V25.
TreeFamiTF329370.

Family and domain databases

InterProiIPR028131. Vasohibin.
[Graphical view]
PfamiPF14822. Vasohibin. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86V25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGSAADTHR CPHPKGAKGT RSRSSHARPV SLATSGGSEE EDKDGGVLFH
60 70 80 90 100
VNKSGFPIDS HTWERMWMHV AKVHPKGGEM VGAIRNAAFL AKPSIPQVPN
110 120 130 140 150
YRLSMTIPDW LQAIQNYMKT LQYNHTGTQF FEIRKMRPLS GLMETAKEMT
160 170 180 190 200
RESLPIKCLE AVILGIYLTN GQPSIERFPI SFKTYFSGNY FHHVVLGIYC
210 220 230 240 250
NGRYGSLGMS RRAELMDKPL TFRTLSDLIF DFEDSYKKYL HTVKKVKIGL
260 270 280 290 300
YVPHEPHSFQ PIEWKQLVLN VSKMLRADIR KELEKYARDM RMKILKPASA
310 320 330 340 350
HSPTQVRSRG KSLSPRRRQA SPPRRLGRRE KSPALPEKKV ADLSTLNEVG

YQIRI
Length:355
Mass (Da):40,450
Last modified:April 12, 2005 - v2
Checksum:iC74C313FEF6A0837
GO
Isoform 2 (identifier: Q86V25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Note: No experimental confirmation available.
Show »
Length:290
Mass (Da):33,538
Checksum:i21042C9BB88CAB7B
GO
Isoform 3 (identifier: Q86V25-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-142: Missing.
     294-298: ILKPA → GLCSH
     299-355: Missing.

Note: No experimental confirmation available.
Show »
Length:156
Mass (Da):18,271
Checksum:i4F1B7393CD050DCE
GO
Isoform 4 (identifier: Q86V25-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-169: YLT → THS
     170-355: Missing.

Note: No experimental confirmation available.
Show »
Length:169
Mass (Da):18,753
Checksum:iE72AD1B6BB438113
GO
Isoform 5 (identifier: Q86V25-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-166: QYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGI → H

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):35,423
Checksum:iE7955D3D5C278530
GO
Isoform 6 (identifier: Q86V25-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:251
Mass (Da):29,253
Checksum:iDB53A4CBB725842F
GO

Sequence cautioni

The sequence CAH71916.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAH71918.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 142142Missing in isoform 3. 1 PublicationVSP_013329Add
BLAST
Alternative sequencei1 – 104104Missing in isoform 6. 1 PublicationVSP_054104Add
BLAST
Alternative sequencei1 – 6565Missing in isoform 2. 1 PublicationVSP_013328Add
BLAST
Alternative sequencei122 – 16645QYNHT…VILGI → H in isoform 5. 1 PublicationVSP_013334Add
BLAST
Alternative sequencei167 – 1693YLT → THS in isoform 4. 1 PublicationVSP_013332
Alternative sequencei170 – 355186Missing in isoform 4. 1 PublicationVSP_013333Add
BLAST
Alternative sequencei294 – 2985ILKPA → GLCSH in isoform 3. 1 PublicationVSP_013330
Alternative sequencei299 – 35557Missing in isoform 3. 1 PublicationVSP_013331Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY834202 mRNA. Translation: AAX39752.1.
AK022567 mRNA. Translation: BAB14103.1.
AK302675 mRNA. Translation: BAG63907.1.
AL592449 Genomic DNA. Translation: CAH71916.1. Different initiation.
AL592449 Genomic DNA. Translation: CAH71917.1.
AL592449 Genomic DNA. Translation: CAH71918.1. Different initiation.
BC028194 mRNA. Translation: AAH28194.1.
BC051856 mRNA. Translation: AAH51856.1.
BC053836 mRNA. Translation: AAH53836.1.
CCDSiCCDS1511.1. [Q86V25-5]
CCDS44315.1. [Q86V25-2]
CCDS44316.1. [Q86V25-6]
CCDS73026.1. [Q86V25-1]
RefSeqiNP_001129946.1. NM_001136474.2. [Q86V25-2]
NP_001129947.1. NM_001136475.2. [Q86V25-6]
NP_001287985.1. NM_001301056.1. [Q86V25-1]
NP_079025.2. NM_024749.4. [Q86V25-5]
XP_011508289.1. XM_011509987.1. [Q86V25-1]
XP_011508290.1. XM_011509988.1. [Q86V25-1]
XP_011508294.1. XM_011509992.1. [Q86V25-6]
XP_011508295.1. XM_011509993.1. [Q86V25-6]
UniGeneiHs.96885.

Genome annotation databases

EnsembliENST00000366964; ENSP00000355931; ENSG00000143494. [Q86V25-4]
ENST00000366965; ENSP00000355932; ENSG00000143494. [Q86V25-5]
ENST00000366966; ENSP00000430319; ENSG00000143494. [Q86V25-2]
ENST00000366967; ENSP00000429040; ENSG00000143494. [Q86V25-6]
ENST00000366968; ENSP00000355935; ENSG00000143494. [Q86V25-2]
ENST00000517399; ENSP00000428324; ENSG00000143494. [Q86V25-1]
GeneIDi79805.
KEGGihsa:79805.
UCSCiuc001hju.3. human. [Q86V25-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY834202 mRNA. Translation: AAX39752.1.
AK022567 mRNA. Translation: BAB14103.1.
AK302675 mRNA. Translation: BAG63907.1.
AL592449 Genomic DNA. Translation: CAH71916.1. Different initiation.
AL592449 Genomic DNA. Translation: CAH71917.1.
AL592449 Genomic DNA. Translation: CAH71918.1. Different initiation.
BC028194 mRNA. Translation: AAH28194.1.
BC051856 mRNA. Translation: AAH51856.1.
BC053836 mRNA. Translation: AAH53836.1.
CCDSiCCDS1511.1. [Q86V25-5]
CCDS44315.1. [Q86V25-2]
CCDS44316.1. [Q86V25-6]
CCDS73026.1. [Q86V25-1]
RefSeqiNP_001129946.1. NM_001136474.2. [Q86V25-2]
NP_001129947.1. NM_001136475.2. [Q86V25-6]
NP_001287985.1. NM_001301056.1. [Q86V25-1]
NP_079025.2. NM_024749.4. [Q86V25-5]
XP_011508289.1. XM_011509987.1. [Q86V25-1]
XP_011508290.1. XM_011509988.1. [Q86V25-1]
XP_011508294.1. XM_011509992.1. [Q86V25-6]
XP_011508295.1. XM_011509993.1. [Q86V25-6]
UniGeneiHs.96885.

3D structure databases

ProteinModelPortaliQ86V25.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122902. 2 interactions.
IntActiQ86V25. 1 interaction.

PTM databases

iPTMnetiQ86V25.
PhosphoSiteiQ86V25.

Polymorphism and mutation databases

BioMutaiVASH2.

Proteomic databases

PRIDEiQ86V25.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000366964; ENSP00000355931; ENSG00000143494. [Q86V25-4]
ENST00000366965; ENSP00000355932; ENSG00000143494. [Q86V25-5]
ENST00000366966; ENSP00000430319; ENSG00000143494. [Q86V25-2]
ENST00000366967; ENSP00000429040; ENSG00000143494. [Q86V25-6]
ENST00000366968; ENSP00000355935; ENSG00000143494. [Q86V25-2]
ENST00000517399; ENSP00000428324; ENSG00000143494. [Q86V25-1]
GeneIDi79805.
KEGGihsa:79805.
UCSCiuc001hju.3. human. [Q86V25-1]

Organism-specific databases

CTDi79805.
GeneCardsiVASH2.
HGNCiHGNC:25723. VASH2.
HPAiHPA045820.
MIMi610471. gene.
neXtProtiNX_Q86V25.
PharmGKBiPA145147736.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000012703.
HOGENOMiHOG000007477.
HOVERGENiHBG079337.
InParanoidiQ86V25.
OMAiMLQYNHT.
OrthoDBiEOG7DC24N.
PhylomeDBiQ86V25.
TreeFamiTF329370.

Miscellaneous databases

ChiTaRSiVASH2. human.
GenomeRNAii79805.
NextBioi69382.
PROiQ86V25.
SOURCEiSearch...

Gene expression databases

BgeeiQ86V25.
CleanExiHS_VASH2.
ExpressionAtlasiQ86V25. baseline and differential.
GenevisibleiQ86V25. HS.

Family and domain databases

InterProiIPR028131. Vasohibin.
[Graphical view]
PfamiPF14822. Vasohibin. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of vasohibin-2 as a homologue of VEGF-inducible endothelium-derived angiogenesis inhibitor vasohibin."
    Shibuya T., Watanabe K., Yamashita H., Shimizu K., Miyashita H., Abe M., Moriya T., Ohta H., Sonoda H., Shimosegawa T., Tabayashi K., Sato Y.
    Arterioscler. Thromb. Vasc. Biol. 26:1051-1057(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, DEVELOPMENTAL STAGE, INDUCTION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6).
    Tissue: Teratocarcinoma.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
    Tissue: Brain and Testis.
  5. "Isolation of a small vasohibin-binding protein (SVBP) and its role in vasohibin secretion."
    Suzuki Y., Kobayashi M., Miyashita H., Ohta H., Sonoda H., Sato Y.
    J. Cell Sci. 123:3094-3101(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SVBP, SUBCELLULAR LOCATION.
  6. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-302, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiVASH2_HUMAN
AccessioniPrimary (citable) accession number: Q86V25
Secondary accession number(s): B4DYZ5
, Q2VT46, Q5VTE7, Q5VTE9, Q7Z6E3, Q8IZ24, Q9H9W5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 12, 2005
Last modified: March 16, 2016
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.