Q86V25 (VASH2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vasohibin-2 Alternative name(s): Vasohibin-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 355 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Angiogenesis inhibitor. Inhibits network formation by endothelial cells. Ref.1 |
| Developmental stage | Expressed in various embryonic organs at 6 to 12 embryonic weeks. Detected in vessels from 20-week embryonic organs as well as in endothelial cells from large vessels in neonate. Ref.1 |
| Induction | By VEGF. Ref.1 |
| Sequence similarities | Belongs to the vasohibin family. |
| Sequence caution | The sequence CAH71916.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH71918.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | positive regulation of angiogenesis Inferred from direct assay. Source: MGI positive regulation of endothelial cell proliferationInferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Inferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86V25-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86V25-2) The sequence of this isoform differs from the canonical sequence as follows: 1-65: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86V25-3) The sequence of this isoform differs from the canonical sequence as follows: 1-142: Missing. 294-298: ILKPA → GLCSH 299-355: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q86V25-4) The sequence of this isoform differs from the canonical sequence as follows: 167-169: YLT → THS 170-355: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q86V25-5) The sequence of this isoform differs from the canonical sequence as follows: 122-166: QYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGI → H | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 355 | 355 | Vasohibin-2 | PRO_0000189982 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 142 | 142 | Missing in isoform 3. | VSP_013329 | |||||
| Alternative sequence | 1 – 65 | 65 | Missing in isoform 2. | VSP_013328 | |||||
| Alternative sequence | 122 – 166 | 45 | QYNHT…VILGI → H in isoform 5. | VSP_013334 | |||||
| Alternative sequence | 167 – 169 | 3 | YLT → THS in isoform 4. | VSP_013332 | |||||
| Alternative sequence | 170 – 355 | 186 | Missing in isoform 4. | VSP_013333 | |||||
| Alternative sequence | 294 – 298 | 5 | ILKPA → GLCSH in isoform 3. | VSP_013330 | |||||
| Alternative sequence | 299 – 355 | 57 | Missing in isoform 3. | VSP_013331 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of vasohibin-2 as a homologue of VEGF-inducible endothelium-derived angiogenesis inhibitor vasohibin." Shibuya T., Watanabe K., Yamashita H., Shimizu K., Miyashita H., Abe M., Moriya T., Ohta H., Sonoda H., Shimosegawa T., Tabayashi K., Sato Y. Arterioscler. Thromb. Vasc. Biol. 26:1051-1057(2006) [PubMed: 16528006] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, DEVELOPMENTAL STAGE, INDUCTION. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Teratocarcinoma. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5). Tissue: Brain and Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY834202 mRNA. Translation: AAX39752.1. AK022567 mRNA. Translation: BAB14103.1. AL592449 Genomic DNA. Translation: CAH71916.1. Different initiation. AL592449 Genomic DNA. Translation: CAH71917.1. AL592449 Genomic DNA. Translation: CAH71918.1. Different initiation. BC028194 mRNA. Translation: AAH28194.1. BC051856 mRNA. Translation: AAH51856.1. BC053836 mRNA. Translation: AAH53836.1. |
| IPI | IPI00328783. IPI00386499. IPI00555607. IPI00556467. IPI00940695. |
| RefSeq | NP_001129946.1. NM_001136474.1. NP_079025.2. NM_024749.3. |
| UniGene | Hs.96885. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q86V25. |
PTM databases | |
| PhosphoSite | Q86V25. |
Proteomic databases | |
| PRIDE | Q86V25. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000366968; ENSP00000355935; ENSG00000143494. |
| GeneID | 79805. |
| KEGG | hsa:79805. |
| UCSC | uc001hju.1. human. uc001hjw.1. human. uc001hjx.1. human. uc001hjy.1. human. |
Organism-specific databases | |
| CTD | 79805. |
| GeneCards | GC01P213123. |
| HGNC | HGNC:25723. VASH2. |
| MIM | 610471. gene. |
| neXtProt | NX_Q86V25. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10532. |
| GeneTree | ENSGT00390000012703. |
| HOVERGEN | HBG079337. |
| OMA | KFARDMR. |
| OrthoDB | EOG4N5VXD. |
Gene expression databases | |
| ArrayExpress | Q86V25. |
| Bgee | Q86V25. |
| CleanEx | HS_VASH2. |
| Genevestigator | Q86V25. |
| GermOnline | ENSG00000143494. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 69382. |
| SOURCE | Search... |
Entry information
| Entry name | VASH2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86V25 Secondary accession number(s): Q2VT46 Q9H9W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with