Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86V20

- FA35A_HUMAN

UniProt

Q86V20 - FA35A_HUMAN

Protein

Protein FAM35A

Gene

FAM35A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 88 (01 Oct 2014)
      Sequence version 1 (01 Jun 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein FAM35A
    Gene namesi
    Name:FAM35A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:28773. FAM35A.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134926879.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 835835Protein FAM35APRO_0000087161Add
    BLAST

    Proteomic databases

    PaxDbiQ86V20.
    PRIDEiQ86V20.

    PTM databases

    PhosphoSiteiQ86V20.

    Expressioni

    Gene expression databases

    BgeeiQ86V20.
    CleanExiHS_FAM35A.
    GenevestigatoriQ86V20.

    Organism-specific databases

    HPAiHPA036582.

    Interactioni

    Protein-protein interaction databases

    BioGridi120024. 1 interaction.
    IntActiQ86V20. 2 interactions.
    STRINGi9606.ENSP00000298784.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86V20.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the FAM35 family.Curated

    Phylogenomic databases

    eggNOGiNOG29453.
    HOGENOMiHOG000112473.
    HOVERGENiHBG081505.
    OMAiSYPLQQD.
    OrthoDBiEOG7S7SF8.
    PhylomeDBiQ86V20.
    TreeFamiTF332107.

    Family and domain databases

    InterProiIPR029715. FAM35A.
    [Graphical view]
    PANTHERiPTHR14495:SF1. PTHR14495:SF1. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86V20-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGGSQVHIF WGAPIAPLKI TVSEDTASLM SVADPWKKIQ LLYSQHSLYL    50
    KDEKQHKNLE NYKVPESIGS PDLSGHFLAN CMNRHVHVKD DFVRSVSETQ 100
    NIESQKIHSS RLSDITSSNM QICGFKSTVP HFTEEEKYQK LLSENKIRDE 150
    QPKHQPDICG KNFNTNLFQL GHKCAAVLDL VCSTEKINIG PEVVQRECVP 200
    TEYHEIQNQC LGLFSSNAVD KSRSEAAVRK VSDLKISTDT EFLSIITSSQ 250
    VAFLAQKKDK RRSPVNKGNV NMETEPKASY GEIRIPEENS IQLDGFTEAY 300
    ESGQNQAYSL ELFSPVCPKT ENSRIHINSD KGLEEHTGSQ ELFSSEDELP 350
    PNEIRIELCS SGILCSQLNT FHKSAIKRSC TSEDKVGQSE ALSRVLQVAK 400
    KMKLISNGGD SAVEMDRRNV SEFKSIKKTS LIKNCDSKSQ KYNCLVMVLS 450
    PCHVKEINIK FGPNSGSKVP LATVTVIDQS ETKKKVFLWR TAAFWAFTVF 500
    LGDIILLTDV VIHEDQWIGE TVLQSTFSSQ LLNLGSYSSI QPEEYSSVVS 550
    EVVLQDLLAY VSSKHSYLRD LPPRQPQRVN SIDFVELEHL QPDVLVHAVL 600
    RVVDFTILTE AVYSYRGQKQ KKVMLTVEQA QDQHYALVLW GPGAAWYPQL 650
    QRKKGVVLIK AQISELAFPI TASQKIALNA HSSLKSIFSS LPNIVYTGCA 700
    KCGLELETDE NRIYKQCFSC LPFTMKKIYY RPALMTAIDG RHDVCIRVES 750
    KLIEKILLNI SADCLNRVIV PSSEITYGMV VADLFHSLLA VSAEPCVLKI 800
    QSLFVLDENS YPLQQDFSLL DFYPDIVKHG ANARL 835
    Length:835
    Mass (Da):93,705
    Last modified:June 1, 2003 - v1
    Checksum:iBD6D1D1E58C2605D
    GO
    Isoform 2 (identifier: Q86V20-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         654-654: K → KGYIWEFKYLFVQCNYTLENLELHTTPWSSCECLFDDDIRAITFKAKFQKSAPSFVKISDLATHLEDKCS

    Note: No experimental confirmation available.

    Show »
    Length:904
    Mass (Da):101,774
    Checksum:i30C5C6575CF199BC
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti529 – 5324SQLL → PRAI in AAD20041. 1 PublicationCurated
    Sequence conflicti723 – 7231F → L in BAB14342. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti132 – 1321F → L.
    Corresponds to variant rs3129520 [ dbSNP | Ensembl ].
    VAR_053997
    Natural varianti550 – 5501S → C.
    Corresponds to variant rs11202365 [ dbSNP | Ensembl ].
    VAR_053998
    Natural varianti747 – 7471R → H.
    Corresponds to variant rs11816168 [ dbSNP | Ensembl ].
    VAR_053999

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei654 – 6541K → KGYIWEFKYLFVQCNYTLEN LELHTTPWSSCECLFDDDIR AITFKAKFQKSAPSFVKISD LATHLEDKCS in isoform 2. 1 PublicationVSP_016165

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022978 mRNA. Translation: BAB14342.1.
    AL645992 Genomic DNA. Translation: CAH70756.1.
    BC051863 mRNA. Translation: AAH51863.1.
    AF131775 mRNA. Translation: AAD20041.1.
    CCDSiCCDS7383.1. [Q86V20-1]
    RefSeqiNP_061927.2. NM_019054.2. [Q86V20-1]
    UniGeneiHs.500419.

    Genome annotation databases

    EnsembliENST00000298784; ENSP00000298784; ENSG00000122376. [Q86V20-1]
    ENST00000298786; ENSP00000298786; ENSG00000122376. [Q86V20-2]
    GeneIDi54537.
    KEGGihsa:54537.
    UCSCiuc001kei.4. human. [Q86V20-1]

    Polymorphism databases

    DMDMi74750445.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022978 mRNA. Translation: BAB14342.1 .
    AL645992 Genomic DNA. Translation: CAH70756.1 .
    BC051863 mRNA. Translation: AAH51863.1 .
    AF131775 mRNA. Translation: AAD20041.1 .
    CCDSi CCDS7383.1. [Q86V20-1 ]
    RefSeqi NP_061927.2. NM_019054.2. [Q86V20-1 ]
    UniGenei Hs.500419.

    3D structure databases

    ProteinModelPortali Q86V20.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120024. 1 interaction.
    IntActi Q86V20. 2 interactions.
    STRINGi 9606.ENSP00000298784.

    PTM databases

    PhosphoSitei Q86V20.

    Polymorphism databases

    DMDMi 74750445.

    Proteomic databases

    PaxDbi Q86V20.
    PRIDEi Q86V20.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000298784 ; ENSP00000298784 ; ENSG00000122376 . [Q86V20-1 ]
    ENST00000298786 ; ENSP00000298786 ; ENSG00000122376 . [Q86V20-2 ]
    GeneIDi 54537.
    KEGGi hsa:54537.
    UCSCi uc001kei.4. human. [Q86V20-1 ]

    Organism-specific databases

    CTDi 54537.
    GeneCardsi GC10P088845.
    H-InvDB HIX0009004.
    HIX0190525.
    HGNCi HGNC:28773. FAM35A.
    HPAi HPA036582.
    neXtProti NX_Q86V20.
    PharmGKBi PA134926879.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG29453.
    HOGENOMi HOG000112473.
    HOVERGENi HBG081505.
    OMAi SYPLQQD.
    OrthoDBi EOG7S7SF8.
    PhylomeDBi Q86V20.
    TreeFami TF332107.

    Miscellaneous databases

    GenomeRNAii 54537.
    NextBioi 56966.
    PROi Q86V20.

    Gene expression databases

    Bgeei Q86V20.
    CleanExi HS_FAM35A.
    Genevestigatori Q86V20.

    Family and domain databases

    InterProi IPR029715. FAM35A.
    [Graphical view ]
    PANTHERi PTHR14495:SF1. PTHR14495:SF1. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye.
    4. Mei G., Yu W., Gibbs R.A.
      Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 529-835 (ISOFORM 2).
      Tissue: Brain.

    Entry informationi

    Entry nameiFA35A_HUMAN
    AccessioniPrimary (citable) accession number: Q86V20
    Secondary accession number(s): O95885, Q9H991
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 22, 2005
    Last sequence update: June 1, 2003
    Last modified: October 1, 2014
    This is version 88 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3