Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86V20

- FA35A_HUMAN

UniProt

Q86V20 - FA35A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein FAM35A

Gene

FAM35A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM35A
Gene namesi
Name:FAM35A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:28773. FAM35A.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134926879.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 835835Protein FAM35APRO_0000087161Add
BLAST

Proteomic databases

MaxQBiQ86V20.
PaxDbiQ86V20.
PRIDEiQ86V20.

PTM databases

PhosphoSiteiQ86V20.

Expressioni

Gene expression databases

BgeeiQ86V20.
CleanExiHS_FAM35A.
ExpressionAtlasiQ86V20. baseline.
GenevestigatoriQ86V20.

Organism-specific databases

HPAiHPA036582.

Interactioni

Protein-protein interaction databases

BioGridi120024. 1 interaction.
IntActiQ86V20. 2 interactions.
STRINGi9606.ENSP00000298784.

Structurei

3D structure databases

ProteinModelPortaliQ86V20.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM35 family.Curated

Phylogenomic databases

eggNOGiNOG29453.
GeneTreeiENSGT00390000003133.
HOGENOMiHOG000112473.
HOVERGENiHBG081505.
InParanoidiQ86V20.
OMAiSYPLQQD.
OrthoDBiEOG7S7SF8.
PhylomeDBiQ86V20.
TreeFamiTF332107.

Family and domain databases

InterProiIPR029715. FAM35A.
[Graphical view]
PANTHERiPTHR14495:SF1. PTHR14495:SF1. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86V20-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGGSQVHIF WGAPIAPLKI TVSEDTASLM SVADPWKKIQ LLYSQHSLYL
60 70 80 90 100
KDEKQHKNLE NYKVPESIGS PDLSGHFLAN CMNRHVHVKD DFVRSVSETQ
110 120 130 140 150
NIESQKIHSS RLSDITSSNM QICGFKSTVP HFTEEEKYQK LLSENKIRDE
160 170 180 190 200
QPKHQPDICG KNFNTNLFQL GHKCAAVLDL VCSTEKINIG PEVVQRECVP
210 220 230 240 250
TEYHEIQNQC LGLFSSNAVD KSRSEAAVRK VSDLKISTDT EFLSIITSSQ
260 270 280 290 300
VAFLAQKKDK RRSPVNKGNV NMETEPKASY GEIRIPEENS IQLDGFTEAY
310 320 330 340 350
ESGQNQAYSL ELFSPVCPKT ENSRIHINSD KGLEEHTGSQ ELFSSEDELP
360 370 380 390 400
PNEIRIELCS SGILCSQLNT FHKSAIKRSC TSEDKVGQSE ALSRVLQVAK
410 420 430 440 450
KMKLISNGGD SAVEMDRRNV SEFKSIKKTS LIKNCDSKSQ KYNCLVMVLS
460 470 480 490 500
PCHVKEINIK FGPNSGSKVP LATVTVIDQS ETKKKVFLWR TAAFWAFTVF
510 520 530 540 550
LGDIILLTDV VIHEDQWIGE TVLQSTFSSQ LLNLGSYSSI QPEEYSSVVS
560 570 580 590 600
EVVLQDLLAY VSSKHSYLRD LPPRQPQRVN SIDFVELEHL QPDVLVHAVL
610 620 630 640 650
RVVDFTILTE AVYSYRGQKQ KKVMLTVEQA QDQHYALVLW GPGAAWYPQL
660 670 680 690 700
QRKKGVVLIK AQISELAFPI TASQKIALNA HSSLKSIFSS LPNIVYTGCA
710 720 730 740 750
KCGLELETDE NRIYKQCFSC LPFTMKKIYY RPALMTAIDG RHDVCIRVES
760 770 780 790 800
KLIEKILLNI SADCLNRVIV PSSEITYGMV VADLFHSLLA VSAEPCVLKI
810 820 830
QSLFVLDENS YPLQQDFSLL DFYPDIVKHG ANARL
Length:835
Mass (Da):93,705
Last modified:June 1, 2003 - v1
Checksum:iBD6D1D1E58C2605D
GO
Isoform 2 (identifier: Q86V20-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: K → KGYIWEFKYLFVQCNYTLENLELHTTPWSSCECLFDDDIRAITFKAKFQKSAPSFVKISDLATHLEDKCS

Note: No experimental confirmation available.

Show »
Length:904
Mass (Da):101,774
Checksum:i30C5C6575CF199BC
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti529 – 5324SQLL → PRAI in AAD20041. 1 PublicationCurated
Sequence conflicti723 – 7231F → L in BAB14342. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti132 – 1321F → L.
Corresponds to variant rs3129520 [ dbSNP | Ensembl ].
VAR_053997
Natural varianti550 – 5501S → C.
Corresponds to variant rs11202365 [ dbSNP | Ensembl ].
VAR_053998
Natural varianti747 – 7471R → H.
Corresponds to variant rs11816168 [ dbSNP | Ensembl ].
VAR_053999

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei654 – 6541K → KGYIWEFKYLFVQCNYTLEN LELHTTPWSSCECLFDDDIR AITFKAKFQKSAPSFVKISD LATHLEDKCS in isoform 2. 1 PublicationVSP_016165

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022978 mRNA. Translation: BAB14342.1.
AL645992 Genomic DNA. Translation: CAH70756.1.
BC051863 mRNA. Translation: AAH51863.1.
AF131775 mRNA. Translation: AAD20041.1.
CCDSiCCDS7383.1. [Q86V20-1]
RefSeqiNP_061927.2. NM_019054.2. [Q86V20-1]
UniGeneiHs.500419.

Genome annotation databases

EnsembliENST00000298784; ENSP00000298784; ENSG00000122376. [Q86V20-1]
ENST00000298786; ENSP00000298786; ENSG00000122376. [Q86V20-2]
GeneIDi54537.
KEGGihsa:54537.
UCSCiuc001kei.4. human. [Q86V20-1]

Polymorphism databases

DMDMi74750445.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022978 mRNA. Translation: BAB14342.1 .
AL645992 Genomic DNA. Translation: CAH70756.1 .
BC051863 mRNA. Translation: AAH51863.1 .
AF131775 mRNA. Translation: AAD20041.1 .
CCDSi CCDS7383.1. [Q86V20-1 ]
RefSeqi NP_061927.2. NM_019054.2. [Q86V20-1 ]
UniGenei Hs.500419.

3D structure databases

ProteinModelPortali Q86V20.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120024. 1 interaction.
IntActi Q86V20. 2 interactions.
STRINGi 9606.ENSP00000298784.

PTM databases

PhosphoSitei Q86V20.

Polymorphism databases

DMDMi 74750445.

Proteomic databases

MaxQBi Q86V20.
PaxDbi Q86V20.
PRIDEi Q86V20.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000298784 ; ENSP00000298784 ; ENSG00000122376 . [Q86V20-1 ]
ENST00000298786 ; ENSP00000298786 ; ENSG00000122376 . [Q86V20-2 ]
GeneIDi 54537.
KEGGi hsa:54537.
UCSCi uc001kei.4. human. [Q86V20-1 ]

Organism-specific databases

CTDi 54537.
GeneCardsi GC10P088845.
H-InvDB HIX0009004.
HIX0190525.
HGNCi HGNC:28773. FAM35A.
HPAi HPA036582.
neXtProti NX_Q86V20.
PharmGKBi PA134926879.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG29453.
GeneTreei ENSGT00390000003133.
HOGENOMi HOG000112473.
HOVERGENi HBG081505.
InParanoidi Q86V20.
OMAi SYPLQQD.
OrthoDBi EOG7S7SF8.
PhylomeDBi Q86V20.
TreeFami TF332107.

Miscellaneous databases

GenomeRNAii 54537.
NextBioi 56966.
PROi Q86V20.

Gene expression databases

Bgeei Q86V20.
CleanExi HS_FAM35A.
ExpressionAtlasi Q86V20. baseline.
Genevestigatori Q86V20.

Family and domain databases

InterProi IPR029715. FAM35A.
[Graphical view ]
PANTHERi PTHR14495:SF1. PTHR14495:SF1. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  4. Mei G., Yu W., Gibbs R.A.
    Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 529-835 (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiFA35A_HUMAN
AccessioniPrimary (citable) accession number: Q86V20
Secondary accession number(s): O95885, Q9H991
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: June 1, 2003
Last modified: October 29, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3