Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM35A

Gene

FAM35A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-32991-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM35A
Gene namesi
Name:FAM35A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:28773. FAM35A.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000122376.
PharmGKBiPA134926879.

Polymorphism and mutation databases

BioMutaiFAM35A.
DMDMi74750445.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000871611 – 835Protein FAM35AAdd BLAST835

Proteomic databases

MaxQBiQ86V20.
PaxDbiQ86V20.
PeptideAtlasiQ86V20.
PRIDEiQ86V20.

PTM databases

iPTMnetiQ86V20.
PhosphoSitePlusiQ86V20.

Expressioni

Gene expression databases

BgeeiENSG00000122376.
CleanExiHS_FAM35A.
ExpressionAtlasiQ86V20. baseline and differential.
GenevisibleiQ86V20. HS.

Organism-specific databases

HPAiHPA036582.

Interactioni

Protein-protein interaction databases

BioGridi120024. 3 interactors.
IntActiQ86V20. 2 interactors.
STRINGi9606.ENSP00000298784.

Structurei

3D structure databases

ProteinModelPortaliQ86V20.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM35 family.Curated

Phylogenomic databases

eggNOGiENOG410IJB7. Eukaryota.
ENOG4111M58. LUCA.
GeneTreeiENSGT00390000003133.
HOGENOMiHOG000112473.
HOVERGENiHBG081505.
InParanoidiQ86V20.
OMAiKNCDSKS.
OrthoDBiEOG091G02V7.
PhylomeDBiQ86V20.
TreeFamiTF332107.

Family and domain databases

InterProiIPR029715. FAM35A.
IPR031589. FAM35A_C.
[Graphical view]
PANTHERiPTHR14495:SF2. PTHR14495:SF2. 1 hit.
PfamiPF15793. FAM35_C. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86V20-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGGSQVHIF WGAPIAPLKI TVSEDTASLM SVADPWKKIQ LLYSQHSLYL
60 70 80 90 100
KDEKQHKNLE NYKVPESIGS PDLSGHFLAN CMNRHVHVKD DFVRSVSETQ
110 120 130 140 150
NIESQKIHSS RLSDITSSNM QICGFKSTVP HFTEEEKYQK LLSENKIRDE
160 170 180 190 200
QPKHQPDICG KNFNTNLFQL GHKCAAVLDL VCSTEKINIG PEVVQRECVP
210 220 230 240 250
TEYHEIQNQC LGLFSSNAVD KSRSEAAVRK VSDLKISTDT EFLSIITSSQ
260 270 280 290 300
VAFLAQKKDK RRSPVNKGNV NMETEPKASY GEIRIPEENS IQLDGFTEAY
310 320 330 340 350
ESGQNQAYSL ELFSPVCPKT ENSRIHINSD KGLEEHTGSQ ELFSSEDELP
360 370 380 390 400
PNEIRIELCS SGILCSQLNT FHKSAIKRSC TSEDKVGQSE ALSRVLQVAK
410 420 430 440 450
KMKLISNGGD SAVEMDRRNV SEFKSIKKTS LIKNCDSKSQ KYNCLVMVLS
460 470 480 490 500
PCHVKEINIK FGPNSGSKVP LATVTVIDQS ETKKKVFLWR TAAFWAFTVF
510 520 530 540 550
LGDIILLTDV VIHEDQWIGE TVLQSTFSSQ LLNLGSYSSI QPEEYSSVVS
560 570 580 590 600
EVVLQDLLAY VSSKHSYLRD LPPRQPQRVN SIDFVELEHL QPDVLVHAVL
610 620 630 640 650
RVVDFTILTE AVYSYRGQKQ KKVMLTVEQA QDQHYALVLW GPGAAWYPQL
660 670 680 690 700
QRKKGVVLIK AQISELAFPI TASQKIALNA HSSLKSIFSS LPNIVYTGCA
710 720 730 740 750
KCGLELETDE NRIYKQCFSC LPFTMKKIYY RPALMTAIDG RHDVCIRVES
760 770 780 790 800
KLIEKILLNI SADCLNRVIV PSSEITYGMV VADLFHSLLA VSAEPCVLKI
810 820 830
QSLFVLDENS YPLQQDFSLL DFYPDIVKHG ANARL
Length:835
Mass (Da):93,705
Last modified:June 1, 2003 - v1
Checksum:iBD6D1D1E58C2605D
GO
Isoform 2 (identifier: Q86V20-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: K → KGYIWEFKYLFVQCNYTLENLELHTTPWSSCECLFDDDIRAITFKAKFQKSAPSFVKISDLATHLEDKCS

Note: No experimental confirmation available.
Show »
Length:904
Mass (Da):101,774
Checksum:i30C5C6575CF199BC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti529 – 532SQLL → PRAI in AAD20041 (Ref. 4) Curated4
Sequence conflicti723F → L in BAB14342 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053997132F → L.Corresponds to variant rs3129520dbSNPEnsembl.1
Natural variantiVAR_053998550S → C.Corresponds to variant rs11202365dbSNPEnsembl.1
Natural variantiVAR_053999747R → H.Corresponds to variant rs11816168dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016165654K → KGYIWEFKYLFVQCNYTLEN LELHTTPWSSCECLFDDDIR AITFKAKFQKSAPSFVKISD LATHLEDKCS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022978 mRNA. Translation: BAB14342.1.
AL645992 Genomic DNA. Translation: CAH70756.1.
BC051863 mRNA. Translation: AAH51863.1.
AF131775 mRNA. Translation: AAD20041.1.
CCDSiCCDS7383.1. [Q86V20-1]
CCDS81484.1. [Q86V20-2]
RefSeqiNP_001317041.1. NM_001330112.1.
NP_061927.2. NM_019054.2. [Q86V20-1]
UniGeneiHs.500419.

Genome annotation databases

EnsembliENST00000298784; ENSP00000298784; ENSG00000122376. [Q86V20-1]
ENST00000298786; ENSP00000298786; ENSG00000122376. [Q86V20-2]
GeneIDi54537.
KEGGihsa:54537.
UCSCiuc001kei.5. human. [Q86V20-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022978 mRNA. Translation: BAB14342.1.
AL645992 Genomic DNA. Translation: CAH70756.1.
BC051863 mRNA. Translation: AAH51863.1.
AF131775 mRNA. Translation: AAD20041.1.
CCDSiCCDS7383.1. [Q86V20-1]
CCDS81484.1. [Q86V20-2]
RefSeqiNP_001317041.1. NM_001330112.1.
NP_061927.2. NM_019054.2. [Q86V20-1]
UniGeneiHs.500419.

3D structure databases

ProteinModelPortaliQ86V20.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120024. 3 interactors.
IntActiQ86V20. 2 interactors.
STRINGi9606.ENSP00000298784.

PTM databases

iPTMnetiQ86V20.
PhosphoSitePlusiQ86V20.

Polymorphism and mutation databases

BioMutaiFAM35A.
DMDMi74750445.

Proteomic databases

MaxQBiQ86V20.
PaxDbiQ86V20.
PeptideAtlasiQ86V20.
PRIDEiQ86V20.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298784; ENSP00000298784; ENSG00000122376. [Q86V20-1]
ENST00000298786; ENSP00000298786; ENSG00000122376. [Q86V20-2]
GeneIDi54537.
KEGGihsa:54537.
UCSCiuc001kei.5. human. [Q86V20-1]

Organism-specific databases

CTDi54537.
GeneCardsiFAM35A.
H-InvDBHIX0009004.
HIX0190525.
HGNCiHGNC:28773. FAM35A.
HPAiHPA036582.
neXtProtiNX_Q86V20.
OpenTargetsiENSG00000122376.
PharmGKBiPA134926879.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJB7. Eukaryota.
ENOG4111M58. LUCA.
GeneTreeiENSGT00390000003133.
HOGENOMiHOG000112473.
HOVERGENiHBG081505.
InParanoidiQ86V20.
OMAiKNCDSKS.
OrthoDBiEOG091G02V7.
PhylomeDBiQ86V20.
TreeFamiTF332107.

Enzyme and pathway databases

BioCyciZFISH:G66-32991-MONOMER.

Miscellaneous databases

GenomeRNAii54537.
PROiQ86V20.

Gene expression databases

BgeeiENSG00000122376.
CleanExiHS_FAM35A.
ExpressionAtlasiQ86V20. baseline and differential.
GenevisibleiQ86V20. HS.

Family and domain databases

InterProiIPR029715. FAM35A.
IPR031589. FAM35A_C.
[Graphical view]
PANTHERiPTHR14495:SF2. PTHR14495:SF2. 1 hit.
PfamiPF15793. FAM35_C. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFA35A_HUMAN
AccessioniPrimary (citable) accession number: Q86V20
Secondary accession number(s): O95885, Q9H991
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: June 1, 2003
Last modified: November 30, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.