Q86V20 (FA35A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 76.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM35A | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 835 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Sequence similarities | Belongs to the FAM35 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86V20-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86V20-2) The sequence of this isoform differs from the canonical sequence as follows: 654-654: K → KGYIWEFKYLFVQCNYTLENLELHTTPWSSCECLFDDDIRAITFKAKFQKSAPSFVKISDLATHLEDKCS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 835 | 835 | Protein FAM35A | PRO_0000087161 | |||||
Natural variations | |||||||||
| Alternative sequence | 654 | 1 | K → KGYIWEFKYLFVQCNYTLEN LELHTTPWSSCECLFDDDIR AITFKAKFQKSAPSFVKISD LATHLEDKCS in isoform 2. | VSP_016165 | |||||
| Natural variant | 132 | 1 | F → L. Corresponds to variant rs3129520 [ dbSNP | Ensembl ]. | VAR_053997 | |||||
| Natural variant | 550 | 1 | S → C. Corresponds to variant rs11202365 [ dbSNP | Ensembl ]. | VAR_053998 | |||||
| Natural variant | 747 | 1 | R → H. Corresponds to variant rs11816168 [ dbSNP | Ensembl ]. | VAR_053999 | |||||
Experimental info | |||||||||
| Sequence conflict | 529 – 532 | 4 | SQLL → PRAI in AAD20041. Ref.4 | ||||||
| Sequence conflict | 723 | 1 | F → L in BAB14342. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [4] | Mei G., Yu W., Gibbs R.A. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 529-835 (ISOFORM 2). Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022978 mRNA. Translation: BAB14342.1. AL645992 Genomic DNA. Translation: CAH70756.1. BC051863 mRNA. Translation: AAH51863.1. AF131775 mRNA. Translation: AAD20041.1. |
| IPI | IPI00005094. IPI00655589. |
| RefSeq | NP_061927.2. NM_019054.2. |
| UniGene | Hs.500419. |
3D structure databases | |
| ProteinModelPortal | Q86V20. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86V20. 2 interactions. |
| STRING | 9606.ENSP00000298784. |
PTM databases | |
| PhosphoSite | Q86V20. |
Polymorphism databases | |
| DMDM | 74750445. |
Proteomic databases | |
| PaxDb | Q86V20. |
| PRIDE | Q86V20. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298784; ENSP00000298784; ENSG00000122376. ENST00000298786; ENSP00000298786; ENSG00000122376. ENST00000358313; ENSP00000351064; ENSG00000122376. |
| GeneID | 54537. |
| KEGG | hsa:54537. |
| UCSC | uc001kei.4. human. |
Organism-specific databases | |
| CTD | 54537. |
| GeneCards | GC10P088845. |
| H-InvDB | HIX0009004. HIX0190525. |
| HGNC | HGNC:28773. FAM35A. |
| HPA | HPA036582. |
| neXtProt | NX_Q86V20. |
| PharmGKB | PA134926879. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG29453. |
| HOGENOM | HOG000112473. |
| HOVERGEN | HBG081505. |
| OMA | KSQKYNC. |
| OrthoDB | EOG4KSPKQ. |
| PhylomeDB | Q86V20. |
Gene expression databases | |
| ArrayExpress | Q86V20. |
| Bgee | Q86V20. |
| CleanEx | HS_FAM35A. |
| Genevestigator | Q86V20. |
| GermOnline | ENSG00000165874. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54537. |
| NextBio | 56966. |
Entry information
| Entry name | FA35A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86V20 Secondary accession number(s): O95885, Q9H991 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
