Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q86V20 (FA35A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein FAM35A
Gene names
Name:FAM35A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length835 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Belongs to the FAM35 family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q86V20-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q86V20-2)

The sequence of this isoform differs from the canonical sequence as follows:
     654-654: K → KGYIWEFKYLFVQCNYTLENLELHTTPWSSCECLFDDDIRAITFKAKFQKSAPSFVKISDLATHLEDKCS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 835835Protein FAM35A
PRO_0000087161

Natural variations

Alternative sequence6541K → KGYIWEFKYLFVQCNYTLEN LELHTTPWSSCECLFDDDIR AITFKAKFQKSAPSFVKISD LATHLEDKCS in isoform 2.
VSP_016165
Natural variant1321F → L.
Corresponds to variant rs3129520 [ dbSNP | Ensembl ].
VAR_053997
Natural variant5501S → C.
Corresponds to variant rs11202365 [ dbSNP | Ensembl ].
VAR_053998
Natural variant7471R → H.
Corresponds to variant rs11816168 [ dbSNP | Ensembl ].
VAR_053999

Experimental info

Sequence conflict529 – 5324SQLL → PRAI in AAD20041. Ref.4
Sequence conflict7231F → L in BAB14342. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2003. Version 1.
Checksum: BD6D1D1E58C2605D

FASTA83593,705
        10         20         30         40         50         60 
MSGGSQVHIF WGAPIAPLKI TVSEDTASLM SVADPWKKIQ LLYSQHSLYL KDEKQHKNLE 

        70         80         90        100        110        120 
NYKVPESIGS PDLSGHFLAN CMNRHVHVKD DFVRSVSETQ NIESQKIHSS RLSDITSSNM 

       130        140        150        160        170        180 
QICGFKSTVP HFTEEEKYQK LLSENKIRDE QPKHQPDICG KNFNTNLFQL GHKCAAVLDL 

       190        200        210        220        230        240 
VCSTEKINIG PEVVQRECVP TEYHEIQNQC LGLFSSNAVD KSRSEAAVRK VSDLKISTDT 

       250        260        270        280        290        300 
EFLSIITSSQ VAFLAQKKDK RRSPVNKGNV NMETEPKASY GEIRIPEENS IQLDGFTEAY 

       310        320        330        340        350        360 
ESGQNQAYSL ELFSPVCPKT ENSRIHINSD KGLEEHTGSQ ELFSSEDELP PNEIRIELCS 

       370        380        390        400        410        420 
SGILCSQLNT FHKSAIKRSC TSEDKVGQSE ALSRVLQVAK KMKLISNGGD SAVEMDRRNV 

       430        440        450        460        470        480 
SEFKSIKKTS LIKNCDSKSQ KYNCLVMVLS PCHVKEINIK FGPNSGSKVP LATVTVIDQS 

       490        500        510        520        530        540 
ETKKKVFLWR TAAFWAFTVF LGDIILLTDV VIHEDQWIGE TVLQSTFSSQ LLNLGSYSSI 

       550        560        570        580        590        600 
QPEEYSSVVS EVVLQDLLAY VSSKHSYLRD LPPRQPQRVN SIDFVELEHL QPDVLVHAVL 

       610        620        630        640        650        660 
RVVDFTILTE AVYSYRGQKQ KKVMLTVEQA QDQHYALVLW GPGAAWYPQL QRKKGVVLIK 

       670        680        690        700        710        720 
AQISELAFPI TASQKIALNA HSSLKSIFSS LPNIVYTGCA KCGLELETDE NRIYKQCFSC 

       730        740        750        760        770        780 
LPFTMKKIYY RPALMTAIDG RHDVCIRVES KLIEKILLNI SADCLNRVIV PSSEITYGMV 

       790        800        810        820        830 
VADLFHSLLA VSAEPCVLKI QSLFVLDENS YPLQQDFSLL DFYPDIVKHG ANARL 

« Hide

Isoform 2 [UniParc].

Checksum: 30C5C6575CF199BC
Show »

FASTA904101,774

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Eye.
[4]Mei G., Yu W., Gibbs R.A.
Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 529-835 (ISOFORM 2).
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK022978 mRNA. Translation: BAB14342.1.
AL645992 Genomic DNA. Translation: CAH70756.1.
BC051863 mRNA. Translation: AAH51863.1.
AF131775 mRNA. Translation: AAD20041.1.
CCDSCCDS7383.1. [Q86V20-1]
RefSeqNP_061927.2. NM_019054.2. [Q86V20-1]
UniGeneHs.500419.

3D structure databases

ProteinModelPortalQ86V20.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120024. 1 interaction.
IntActQ86V20. 2 interactions.
STRING9606.ENSP00000298784.

PTM databases

PhosphoSiteQ86V20.

Polymorphism databases

DMDM74750445.

Proteomic databases

PaxDbQ86V20.
PRIDEQ86V20.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000298784; ENSP00000298784; ENSG00000122376. [Q86V20-1]
ENST00000298786; ENSP00000298786; ENSG00000122376. [Q86V20-2]
GeneID54537.
KEGGhsa:54537.
UCSCuc001kei.4. human. [Q86V20-1]

Organism-specific databases

CTD54537.
GeneCardsGC10P088845.
H-InvDBHIX0009004.
HIX0190525.
HGNCHGNC:28773. FAM35A.
HPAHPA036582.
neXtProtNX_Q86V20.
PharmGKBPA134926879.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG29453.
HOGENOMHOG000112473.
HOVERGENHBG081505.
OMASYPLQQD.
OrthoDBEOG7S7SF8.
PhylomeDBQ86V20.
TreeFamTF332107.

Gene expression databases

BgeeQ86V20.
CleanExHS_FAM35A.
GenevestigatorQ86V20.

Family and domain databases

ProtoNetSearch...

Other

GenomeRNAi54537.
NextBio56966.
PROQ86V20.

Entry information

Entry nameFA35A_HUMAN
AccessionPrimary (citable) accession number: Q86V20
Secondary accession number(s): O95885, Q9H991
Entry history
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: June 1, 2003
Last modified: July 9, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM