Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 40

Gene

NAA40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Responsible for the acetylation of the N-terminal residues of histones H4 and H2A.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.3.1.88. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 40 (EC:2.3.1.-)
Alternative name(s):
N-acetyltransferase 11
NatD catalytic subunit
Gene namesi
Name:NAA40
Synonyms:NAT11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:25845. NAA40.

Pathology & Biotechi

Organism-specific databases

DisGeNETi79829.
OpenTargetsiENSG00000110583.
PharmGKBiPA165543497.

Polymorphism and mutation databases

BioMutaiNAA40.
DMDMi74727506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedSequence analysis
ChainiPRO_00002848972 – 237N-alpha-acetyltransferase 40Add BLAST236

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineSequence analysis1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

EPDiQ86UY6.
MaxQBiQ86UY6.
PaxDbiQ86UY6.
PeptideAtlasiQ86UY6.
PRIDEiQ86UY6.

PTM databases

iPTMnetiQ86UY6.
PhosphoSitePlusiQ86UY6.

Expressioni

Gene expression databases

BgeeiENSG00000110583.
CleanExiHS_NAT11.
ExpressionAtlasiQ86UY6. baseline and differential.
GenevisibleiQ86UY6. HS.

Organism-specific databases

HPAiHPA037816.

Interactioni

Protein-protein interaction databases

BioGridi122921. 21 interactors.
DIPiDIP-61383N.
STRINGi9606.ENSP00000367024.

Structurei

Secondary structure

1237
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi25 – 33Combined sources9
Helixi38 – 41Combined sources4
Helixi43 – 46Combined sources4
Beta strandi47 – 50Combined sources4
Beta strandi55 – 61Combined sources7
Helixi62 – 64Combined sources3
Helixi67 – 86Combined sources20
Beta strandi88 – 90Combined sources3
Helixi94 – 102Combined sources9
Beta strandi107 – 113Combined sources7
Turni114 – 116Combined sources3
Beta strandi117 – 129Combined sources13
Beta strandi132 – 142Combined sources11
Helixi144 – 146Combined sources3
Beta strandi148 – 150Combined sources3
Helixi151 – 165Combined sources15
Beta strandi169 – 176Combined sources8
Helixi180 – 187Combined sources8
Turni201 – 203Combined sources3
Beta strandi210 – 217Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4U9VX-ray1.78B25-220[»]
4U9WX-ray2.49A/B/C/D17-220[»]
ProteinModelPortaliQ86UY6.
SMRiQ86UY6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini63 – 216N-acetyltransferasePROSITE-ProRule annotationAdd BLAST154

Sequence similaritiesi

Contains 1 N-acetyltransferase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2488. Eukaryota.
ENOG4110YSF. LUCA.
GeneTreeiENSGT00390000014903.
HOGENOMiHOG000285996.
HOVERGENiHBG104005.
InParanoidiQ86UY6.
KOiK20794.
OMAiTHGGGHC.
OrthoDBiEOG091G0M04.
PhylomeDBiQ86UY6.
TreeFamiTF315129.

Family and domain databases

Gene3Di3.40.630.30. 1 hit.
InterProiIPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
[Graphical view]
PfamiPF00583. Acetyltransf_1. 1 hit.
[Graphical view]
SUPFAMiSSF55729. SSF55729. 1 hit.
PROSITEiPS51186. GNAT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86UY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRKSSKAKE KKQKRLEERA AMDAVCAKVD AANRLGDPLE AFPVFKKYDR
60 70 80 90 100
NGLNVSIECK RVSGLEPATV DWAFDLTKTN MQTMYEQSEW GWKDREKREE
110 120 130 140 150
MTDDRAWYLI AWENSSVPVA FSHFRFDVEC GDEVLYCYEV QLESKVRRKG
160 170 180 190 200
LGKFLIQILQ LMANSTQMKK VMLTVFKHNH GAYQFFREAL QFEIDDSSPS
210 220 230
MSGCCGEDCS YEILSRRTKF GDSHHSHAGG HCGGCCH
Length:237
Mass (Da):27,194
Last modified:June 1, 2003 - v1
Checksum:iAED75B559073FCE1
GO
Isoform 2 (identifier: Q86UY6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):24,752
Checksum:i83E9980A0920A713
GO
Isoform 3 (identifier: Q86UY6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRN → MPFVPKWTLPT

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,714
Checksum:iD4A061680453A84E
GO

Sequence cautioni

The sequence CAI46006 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti233G → S in BAB14720 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542731 – 51MGRKS…KYDRN → MPFVPKWTLPT in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0542741 – 21Missing in isoform 2. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023910 mRNA. Translation: BAB14720.1.
AK299041 mRNA. Translation: BAG61115.1.
AK300451 mRNA. Translation: BAG62172.1.
BX647309 Transcribed RNA. Translation: CAI46006.1. Sequence problems.
AP003780 Genomic DNA. No translation available.
BC041617 mRNA. Translation: AAH41617.1.
BC052298 mRNA. Translation: AAH52298.1.
CCDSiCCDS73311.1. [Q86UY6-3]
CCDS8053.1. [Q86UY6-1]
RefSeqiNP_001287729.1. NM_001300800.1. [Q86UY6-3]
NP_079047.2. NM_024771.3. [Q86UY6-1]
UniGeneiHs.523753.

Genome annotation databases

EnsembliENST00000377793; ENSP00000367024; ENSG00000110583. [Q86UY6-1]
ENST00000542163; ENSP00000442055; ENSG00000110583. [Q86UY6-3]
GeneIDi79829.
KEGGihsa:79829.
UCSCiuc009yoz.4. human. [Q86UY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023910 mRNA. Translation: BAB14720.1.
AK299041 mRNA. Translation: BAG61115.1.
AK300451 mRNA. Translation: BAG62172.1.
BX647309 Transcribed RNA. Translation: CAI46006.1. Sequence problems.
AP003780 Genomic DNA. No translation available.
BC041617 mRNA. Translation: AAH41617.1.
BC052298 mRNA. Translation: AAH52298.1.
CCDSiCCDS73311.1. [Q86UY6-3]
CCDS8053.1. [Q86UY6-1]
RefSeqiNP_001287729.1. NM_001300800.1. [Q86UY6-3]
NP_079047.2. NM_024771.3. [Q86UY6-1]
UniGeneiHs.523753.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4U9VX-ray1.78B25-220[»]
4U9WX-ray2.49A/B/C/D17-220[»]
ProteinModelPortaliQ86UY6.
SMRiQ86UY6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122921. 21 interactors.
DIPiDIP-61383N.
STRINGi9606.ENSP00000367024.

PTM databases

iPTMnetiQ86UY6.
PhosphoSitePlusiQ86UY6.

Polymorphism and mutation databases

BioMutaiNAA40.
DMDMi74727506.

Proteomic databases

EPDiQ86UY6.
MaxQBiQ86UY6.
PaxDbiQ86UY6.
PeptideAtlasiQ86UY6.
PRIDEiQ86UY6.

Protocols and materials databases

DNASUi79829.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377793; ENSP00000367024; ENSG00000110583. [Q86UY6-1]
ENST00000542163; ENSP00000442055; ENSG00000110583. [Q86UY6-3]
GeneIDi79829.
KEGGihsa:79829.
UCSCiuc009yoz.4. human. [Q86UY6-1]

Organism-specific databases

CTDi79829.
DisGeNETi79829.
GeneCardsiNAA40.
HGNCiHGNC:25845. NAA40.
HPAiHPA037816.
neXtProtiNX_Q86UY6.
OpenTargetsiENSG00000110583.
PharmGKBiPA165543497.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2488. Eukaryota.
ENOG4110YSF. LUCA.
GeneTreeiENSGT00390000014903.
HOGENOMiHOG000285996.
HOVERGENiHBG104005.
InParanoidiQ86UY6.
KOiK20794.
OMAiTHGGGHC.
OrthoDBiEOG091G0M04.
PhylomeDBiQ86UY6.
TreeFamiTF315129.

Enzyme and pathway databases

BRENDAi2.3.1.88. 2681.

Miscellaneous databases

ChiTaRSiNAA40. human.
GenomeRNAii79829.
PROiQ86UY6.

Gene expression databases

BgeeiENSG00000110583.
CleanExiHS_NAT11.
ExpressionAtlasiQ86UY6. baseline and differential.
GenevisibleiQ86UY6. HS.

Family and domain databases

Gene3Di3.40.630.30. 1 hit.
InterProiIPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
[Graphical view]
PfamiPF00583. Acetyltransf_1. 1 hit.
[Graphical view]
SUPFAMiSSF55729. SSF55729. 1 hit.
PROSITEiPS51186. GNAT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNAA40_HUMAN
AccessioniPrimary (citable) accession number: Q86UY6
Secondary accession number(s): B4DR03
, B4DU10, Q5HYL5, Q9H897
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: June 1, 2003
Last modified: November 30, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.