Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-alpha-acetyltransferase 40

Gene

NAA40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Ser-Gly-Arg-Gly sequence' (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism (By similarity).By similarity3 Publications

Catalytic activityi

Acetyl-CoA + an N-terminal-L-seryl-[histone H4] = an N-terminal-N(alpha)-acetyl-L-seryl-[histone H4] + CoA.2 Publications
Acetyl-CoA + an N-terminal-L-seryl-[histone H2A] = an N-terminal-N(alpha)-acetyl-L-seryl-[histone H2A] + CoA.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei85SubstrateCombined sources1 Publication1
Binding sitei138SubstrateCombined sources1 Publication1
Sitei139Essential for catalytic activity1 Publication1
Binding sitei174SubstrateCombined sources1 Publication1
Binding sitei179Acetyl-CoACombined sources1 Publication1
Binding sitei197SubstrateCombined sources1 Publication1
Binding sitei211SubstrateCombined sources1 Publication1

GO - Molecular functioni

  • H2A histone acetyltransferase activity Source: UniProtKB
  • H4 histone acetyltransferase activity Source: UniProtKB
  • peptide-serine-N-acetyltransferase activity Source: UniProtKB

GO - Biological processi

  • histone H2A acetylation Source: UniProtKB
  • histone H4 acetylation Source: UniProtKB
  • lipid metabolic process Source: Ensembl
  • N-terminal protein amino acid acetylation Source: UniProtKB

Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.3.1.88. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
N-alpha-acetyltransferase 401 PublicationImported (EC:2.3.1.2572 Publications)
Alternative name(s):
N-acetyltransferase 11
N-alpha-acetyltransferase D1 Publication
Short name:
NatD1 Publication
Short name:
hNatD1 Publication
Protein acetyltransferase 11 Publication
Gene namesi
Name:NAA401 PublicationImported
Synonyms:NAT11, PATT11 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000110583.12.
HGNCiHGNC:25845. NAA40.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi85Y → A: Strongly reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi90W → A: Strongly reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi100E → A: 5 times reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi127 – 129DVE → AVA: Strongly reduced N-alpha-acetyltransferase activity. 1 Publication3
Mutagenesisi136Y → A: Strongly reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi136Y → F: Slightly reduced N-alpha-acetyltransferase activity. 2 Publications1
Mutagenesisi137C → A: Reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi138Y → A: Strongly reduced N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi139E → Q: Abolished N-alpha-acetyltransferase activity. 2 Publications1
Mutagenesisi174T → A: Does not affect N-alpha-acetyltransferase activity. 1 Publication1
Mutagenesisi211Y → A: Does not affect N-alpha-acetyltransferase activity. 1 Publication1

Organism-specific databases

DisGeNETi79829.
OpenTargetsiENSG00000110583.
PharmGKBiPA165543497.

Polymorphism and mutation databases

BioMutaiNAA40.
DMDMi74727506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedSequence analysis
ChainiPRO_00002848972 – 237N-alpha-acetyltransferase 40Add BLAST236

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineSequence analysis1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

EPDiQ86UY6.
MaxQBiQ86UY6.
PaxDbiQ86UY6.
PeptideAtlasiQ86UY6.
PRIDEiQ86UY6.

PTM databases

iPTMnetiQ86UY6.
PhosphoSitePlusiQ86UY6.

Expressioni

Tissue specificityi

Widely expressed; with the highest expression level in liver and the lowest expression in brain (at protein level).1 Publication

Inductioni

Down-regulated in hepatocellular carcinoma tissues.1 Publication

Gene expression databases

BgeeiENSG00000110583.
CleanExiHS_NAT11.
ExpressionAtlasiQ86UY6. baseline and differential.
GenevisibleiQ86UY6. HS.

Organism-specific databases

HPAiHPA037816.

Interactioni

Protein-protein interaction databases

BioGridi122921. 22 interactors.
DIPiDIP-61383N.
STRINGi9606.ENSP00000367024.

Structurei

Secondary structure

1237
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi25 – 33Combined sources9
Helixi38 – 41Combined sources4
Helixi43 – 46Combined sources4
Beta strandi47 – 50Combined sources4
Beta strandi55 – 61Combined sources7
Helixi62 – 64Combined sources3
Helixi67 – 86Combined sources20
Beta strandi88 – 90Combined sources3
Helixi94 – 102Combined sources9
Beta strandi107 – 113Combined sources7
Turni114 – 116Combined sources3
Beta strandi117 – 129Combined sources13
Beta strandi132 – 142Combined sources11
Helixi144 – 146Combined sources3
Beta strandi148 – 150Combined sources3
Helixi151 – 165Combined sources15
Beta strandi169 – 176Combined sources8
Helixi180 – 187Combined sources8
Turni201 – 203Combined sources3
Beta strandi210 – 217Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4U9VX-ray1.78B25-220[»]
4U9WX-ray2.49A/B/C/D17-220[»]
ProteinModelPortaliQ86UY6.
SMRiQ86UY6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini63 – 216N-acetyltransferasePROSITE-ProRule annotationAdd BLAST154

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni127 – 129Substrate bindingCombined sources1 Publication3
Regioni140 – 142Acetyl-CoA bindingCombined sources1 Publication3
Regioni148 – 153Acetyl-CoA bindingCombined sources1 Publication6

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2488. Eukaryota.
ENOG4110YSF. LUCA.
GeneTreeiENSGT00390000014903.
HOGENOMiHOG000285996.
HOVERGENiHBG104005.
InParanoidiQ86UY6.
KOiK20794.
OMAiMGWQPKI.
OrthoDBiEOG091G0M04.
PhylomeDBiQ86UY6.
TreeFamiTF315129.

Family and domain databases

InterProiView protein in InterPro
IPR016181. Acyl_CoA_acyltransferase.
IPR000182. GNAT_dom.
PfamiView protein in Pfam
PF00583. Acetyltransf_1. 1 hit.
SUPFAMiSSF55729. SSF55729. 1 hit.
PROSITEiView protein in PROSITE
PS51186. GNAT. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86UY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRKSSKAKE KKQKRLEERA AMDAVCAKVD AANRLGDPLE AFPVFKKYDR
60 70 80 90 100
NGLNVSIECK RVSGLEPATV DWAFDLTKTN MQTMYEQSEW GWKDREKREE
110 120 130 140 150
MTDDRAWYLI AWENSSVPVA FSHFRFDVEC GDEVLYCYEV QLESKVRRKG
160 170 180 190 200
LGKFLIQILQ LMANSTQMKK VMLTVFKHNH GAYQFFREAL QFEIDDSSPS
210 220 230
MSGCCGEDCS YEILSRRTKF GDSHHSHAGG HCGGCCH
Length:237
Mass (Da):27,194
Last modified:June 1, 2003 - v1
Checksum:iAED75B559073FCE1
GO
Isoform 2 (identifier: Q86UY6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Note: No experimental confirmation available.
Show »
Length:216
Mass (Da):24,752
Checksum:i83E9980A0920A713
GO
Isoform 3 (identifier: Q86UY6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRN → MPFVPKWTLPT

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,714
Checksum:iD4A061680453A84E
GO

Sequence cautioni

The sequence CAI46006 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti233G → S in BAB14720 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542731 – 51MGRKS…KYDRN → MPFVPKWTLPT in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0542741 – 21Missing in isoform 2. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023910 mRNA. Translation: BAB14720.1.
AK299041 mRNA. Translation: BAG61115.1.
AK300451 mRNA. Translation: BAG62172.1.
BX647309 Transcribed RNA. Translation: CAI46006.1. Sequence problems.
AP003780 Genomic DNA. No translation available.
BC041617 mRNA. Translation: AAH41617.1.
BC052298 mRNA. Translation: AAH52298.1.
CCDSiCCDS73311.1. [Q86UY6-3]
CCDS8053.1. [Q86UY6-1]
RefSeqiNP_001287729.1. NM_001300800.1. [Q86UY6-3]
NP_079047.2. NM_024771.3. [Q86UY6-1]
UniGeneiHs.523753.

Genome annotation databases

EnsembliENST00000377793; ENSP00000367024; ENSG00000110583. [Q86UY6-1]
ENST00000542163; ENSP00000442055; ENSG00000110583. [Q86UY6-3]
GeneIDi79829.
KEGGihsa:79829.
UCSCiuc009yoz.4. human. [Q86UY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNAA40_HUMAN
AccessioniPrimary (citable) accession number: Q86UY6
Secondary accession number(s): B4DR03
, B4DU10, Q5HYL5, Q9H897
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: June 1, 2003
Last modified: September 27, 2017
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families