Q86UT5 (NHRF4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Na(+)/H(+) exchange regulatory cofactor NHE-RF4 Short name=NHERF-4 Alternative name(s): Intestinal and kidney-enriched PDZ protein Natrium-phosphate cotransporter IIa C-terminal-associated protein 2 Short name=Na/Pi cotransporter C-terminal-associated protein 2 Short name=NaPi-Cap2 PDZ domain-containing protein 2 PDZ domain-containing protein 3 Sodium-hydrogen exchanger regulatory factor 4 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 571 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a regulatory protein that associates with GUCY2C and negatively modulates its heat-stable enterotoxin-mediated activation. Stimulates SLC9A3 activity in the presence of elevated calcium ions. Ref.1 Ref.6 |
| Subunit structure | Interacts with the C-terminal region of GUCY2C. Interacts with the C-terminal region of SLC34A1. Interacts with the C-terminal region SLC9A3 and the interactions decrease in response to elevated calcium ion levels. Ref.1 Ref.6 UniProtKB Q99MJ6 |
| Subcellular location | Cell membrane; Peripheral membrane protein. Cytoplasm. Note: Preferentially accumulates at the apical surface and ileal brush border of intestinal epithelial cells. Ref.1 Ref.6 |
| Tissue specificity | Expressed in kidney and the gastrointestinal tract. Not detected in brain, heart, skeletal muscle or cells of hematopoietic origin. Ref.1 |
| Sequence similarities | Contains 4 PDZ (DHR) domains. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.2 (identifier: Q86UT5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q86UT5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. 67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY | ||||||
| Isoform 3 (identifier: Q86UT5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. 67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY 272-285: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q86UT5-4) The sequence of this isoform differs from the canonical sequence as follows: 355-386: QFLWEVDPGLPAKKAGMQAGDRLVAVAGESVE → EWEPWGRWGKVGLGVGTQAYIHLSVHRRGVPV 387-571: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q86UT5-5) The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. 67-105: TRQKLPSTLS...PLFCCPPHPP → MEKAADLQDT...LSLAEDHDPY 287-571: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 571 | 571 | Na(+)/H(+) exchange regulatory cofactor NHE-RF4 | PRO_0000058292 | |||||||||||||||||||
Regions | |||||||||||||||||||||||
| Domain | 115 – 196 | 82 | PDZ 1 | ||||||||||||||||||||
| Domain | 223 – 301 | 79 | PDZ 2 | ||||||||||||||||||||
| Domain | 329 – 412 | 84 | PDZ 3 | ||||||||||||||||||||
| Domain | 467 – 548 | 82 | PDZ 4 | ||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform 2, isoform 3 and isoform 5. Ref.1 | VSP_051786 | |||||||||||||||||||
| Alternative sequence | 67 – 105 | 39 | TRQKL…PPHPP → MEKAADLQDTASLTLKFKFN PKLGIDNPVLSLAEDHDPY in isoform 2, isoform 3 and isoform 5. Ref.1 | VSP_051787 | |||||||||||||||||||
| Alternative sequence | 272 – 285 | 14 | Missing in isoform 3. Ref.1 | VSP_051788 | |||||||||||||||||||
| Alternative sequence | 287 – 571 | 285 | Missing in isoform 5. Ref.1 | VSP_051789 | |||||||||||||||||||
| Alternative sequence | 355 – 386 | 32 | QFLWE…GESVE → EWEPWGRWGKVGLGVGTQAY IHLSVHRRGVPV in isoform 4. Ref.1 | VSP_051790 | |||||||||||||||||||
| Alternative sequence | 387 – 571 | 185 | Missing in isoform 4. Ref.1 | VSP_051791 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Sequence conflict | 112 | 1 | R → P in BAB15474. Ref.3 | ||||||||||||||||||||
| Sequence conflict | 125 | 1 | S → G in BAC03780. Ref.3 | ||||||||||||||||||||
| Sequence conflict | 286 | 1 | L → V in BAB15474. Ref.3 | ||||||||||||||||||||
| Sequence conflict | 438 | 1 | R → Q in BAC76050. Ref.2 | ||||||||||||||||||||
| Sequence conflict | 438 | 1 | R → Q in AAH29042. Ref.5 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Beta strand | 328 – 333 | 6 | |||||||||||||||||||||
| Beta strand | 341 – 347 | 7 | |||||||||||||||||||||
| Beta strand | 353 – 360 | 8 | |||||||||||||||||||||
| Helix | 365 – 368 | 4 | |||||||||||||||||||||
| Beta strand | 375 – 380 | 6 | |||||||||||||||||||||
| Helix | 390 – 398 | 9 | |||||||||||||||||||||
| Turn | 399 – 402 | 4 | |||||||||||||||||||||
| Beta strand | 403 – 409 | 7 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel PDZ protein regulates the activity of guanylyl cyclase C, the heat-stable enterotoxin receptor." Scott R.O., Thelin W.R., Milgram S.L. J. Biol. Chem. 277:22934-22941(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH GUCY2C, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Intestinal epithelium. |
| [2] | "Identification of a 500-kb region of common allelic loss in chromosome 11q23 in non-MYCN amplified type of neuroblastoma." Kubo T., Arai Y., Ohira M., Gamou T., Maeno G., Sakiyama T., Toyoda A., Hattori M., Sakaki Y., Nakagawara A., Ohki M. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). Tissue: Ileal mucosa and Kidney. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [6] | "Elevated intracellular calcium stimulates NHE3 activity by an IKEPP (NHERF4) dependent mechanism." Zachos N.C., Hodson C., Kovbasnjuk O., Li X., Thelin W.R., Cha B., Milgram S., Donowitz M. Cell. Physiol. Biochem. 22:693-704(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SLC9A3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY047359 mRNA. Translation: AAL10686.1. AB094096 mRNA. Translation: BAC76050.1. AK026409 mRNA. Translation: BAB15474.1. AK091966 mRNA. Translation: BAC03780.1. AP002956 Genomic DNA. No translation available. BC029042 mRNA. Translation: AAH29042.1. | ||||||||||||
| IPI | IPI00171635. IPI00384252. IPI00478167. IPI00641673. IPI00646546. | ||||||||||||
| RefSeq | NP_001161940.1. NM_001168468.1. NP_079067.3. NM_024791.3. | ||||||||||||
| UniGene | Hs.374726. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q86UT5. | ||||||||||||
| SMR | Q86UT5. Positions 113-193, 221-415, 464-545. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| MINT | MINT-1773252. | ||||||||||||
| STRING | 9606.ENSP00000327107. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q86UT5. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 308153467. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q86UT5. | ||||||||||||
| PRIDE | Q86UT5. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000322712; ENSP00000327107; ENSG00000172367. ENST00000355547; ENSP00000347742; ENSG00000172367. ENST00000392817; ENSP00000376564; ENSG00000172367. ENST00000531114; ENSP00000431164; ENSG00000172367. | ||||||||||||
| GeneID | 79849. | ||||||||||||
| KEGG | hsa:79849. | ||||||||||||
| UCSC | uc001pvz.3. human. uc001pwb.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 79849. | ||||||||||||
| GeneCards | GC11P119056. | ||||||||||||
| H-InvDB | HIX0201614. | ||||||||||||
| HGNC | HGNC:19891. PDZD3. | ||||||||||||
| HPA | HPA040482. | ||||||||||||
| MIM | 607146. gene. | ||||||||||||
| neXtProt | NX_Q86UT5. | ||||||||||||
| PharmGKB | PA134911718. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG262468. | ||||||||||||
| HOGENOM | HOG000048712. | ||||||||||||
| HOVERGEN | HBG080760. | ||||||||||||
| InParanoid | Q86UT5. | ||||||||||||
| OMA | FSMVRLS. | ||||||||||||
| OrthoDB | EOG412M5D. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q86UT5. | ||||||||||||
| Bgee | Q86UT5. | ||||||||||||
| CleanEx | HS_PDZD3. | ||||||||||||
| Genevestigator | Q86UT5. | ||||||||||||
| GermOnline | ENSG00000172367. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001478. PDZ. [Graphical view] | ||||||||||||
| Pfam | PF00595. PDZ. 4 hits. [Graphical view] | ||||||||||||
| SMART | SM00228. PDZ. 4 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 4 hits. | ||||||||||||
| PROSITE | PS50106. PDZ. 4 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q86UT5. | ||||||||||||
| GenomeRNAi | 79849. | ||||||||||||
| NextBio | 69555. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NHRF4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86UT5 Secondary accession number(s): Q8N6R4 Q9H5Z3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
