Q86US8 (EST1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Telomerase-binding protein EST1A EC=3.1.-.- Alternative name(s): EST1-like protein A Ever shorter telomeres 1A Smg-6 homolog Telomerase subunit EST1A hSmg5/7a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1419 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. May have a general role in telomere regulation. Promotes in vitro the ability of TERT to elongate telomeres. Overexpression induces telomere uncapping, chromosomal end-to-end fusions (telomeric DNA persists at the fusion points) and did not perturb TRF2 telomeric localization. Binds to the single-stranded 5'-(GTGTGG)4GTGT-3' telomeric DNA, but not to a telomerase RNA template component (TER). Ref.1 Ref.5 Ref.9 Ref.10 Ref.14 Plays a role in nonsense-mediated mRNA decay. Is thought to provide a link to the mRNA degradation machinery as it has endonuclease activity required to initiate NMD, and to serve as an adapter for UPF1 to protein phosphatase 2A (PP2A), thereby triggering UPF1 dephosphorylation. Degrades single-stranded RNA (ssRNA), but not ssDNA or dsRNA. Ref.1 Ref.5 Ref.9 Ref.10 Ref.14 |
| Cofactor | Manganese. Ref.14 |
| Subunit structure | Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Interacts with TERT, independently of the telomerase RNA. Interacts with PP2A catalytic subunits, SMG1, UPF1, UPF2 and UPF3B. Ref.1 Ref.5 Ref.7 Ref.10 Ref.12 |
| Subcellular location | Nucleus › nucleolus. Chromosome › telomere Probable. Cytoplasm › cytosol. Note: Particularly enriched in the nucleolus. Ref.1 Ref.10 |
| Tissue specificity | |
| Domain | The PINc domain confers endonuclease activity and is expected to bind the catalytic metal ion. Ref.9 Ref.10 |
| Sequence similarities | Contains 1 PINc domain. |
| Sequence caution | The sequence AAH64916.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAA34452.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| UPF1 | Q92900-2 | 2 | EBI-3232100,EBI-373492 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86US8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86US8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1089: Missing. 1090-1119: ILEEDRLLSGFVPLLAAPQDPCYVEKTSDK → MRFRLCHQRGCCPHERENTCTCKMIISSLQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1419 | 1419 | Telomerase-binding protein EST1A | PRO_0000087069 | ||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||
| Domain | 1246 – 1397 | 152 | PINc | |||||||||||||||||||||||||||||
| Region | 114 – 503 | 390 | Interaction with telomeric DNA | |||||||||||||||||||||||||||||
| Coiled coil | 163 – 193 | 31 | Potential | |||||||||||||||||||||||||||||
| Coiled coil | 567 – 625 | 59 | Potential | |||||||||||||||||||||||||||||
| Coiled coil | 1197 – 1239 | 43 | Potential | |||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||
| Metal binding | 1251 | 1 | Manganese; catalytic Probable | |||||||||||||||||||||||||||||
| Metal binding | 1353 | 1 | Manganese; catalytic Probable | |||||||||||||||||||||||||||||
| Metal binding | 1392 | 1 | Manganese; catalytic Probable | |||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||
| Modified residue | 479 | 1 | Phosphothreonine Ref.11 | |||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1089 | 1089 | Missing in isoform 2. | VSP_010360 | ||||||||||||||||||||||||||||
| Alternative sequence | 1090 – 1119 | 30 | ILEED…KTSDK → MRFRLCHQRGCCPHERENTC TCKMIISSLQ in isoform 2. | VSP_010361 | ||||||||||||||||||||||||||||
| Natural variant | 291 | 1 | R → P. Ref.2 Corresponds to variant rs1885986 [ dbSNP | Ensembl ]. | VAR_018499 | ||||||||||||||||||||||||||||
| Natural variant | 294 | 1 | K → Q. Corresponds to variant rs216195 [ dbSNP | Ensembl ]. | VAR_018500 | ||||||||||||||||||||||||||||
| Natural variant | 341 | 1 | N → T. Ref.1 Ref.2 Corresponds to variant rs1885987 [ dbSNP | Ensembl ]. | VAR_018501 | ||||||||||||||||||||||||||||
| Natural variant | 575 | 1 | N → S. Corresponds to variant rs34047637 [ dbSNP | Ensembl ]. | VAR_050978 | ||||||||||||||||||||||||||||
| Natural variant | 972 | 1 | A → T. Corresponds to variant rs903160 [ dbSNP | Ensembl ]. | VAR_018502 | ||||||||||||||||||||||||||||
| Natural variant | 984 | 1 | R → C. Corresponds to variant rs35173108 [ dbSNP | Ensembl ]. | VAR_050979 | ||||||||||||||||||||||||||||
| Natural variant | 1189 | 1 | E → K. Corresponds to variant rs58801957 [ dbSNP | Ensembl ]. | VAR_061648 | ||||||||||||||||||||||||||||
| Natural variant | 1233 | 1 | H → R. Corresponds to variant rs2273980 [ dbSNP | Ensembl ]. | VAR_018503 | ||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||
| Mutagenesis | 1251 | 1 | D → A: Impaired nonsense-mediated RNA decay. Ref.9 Ref.10 | |||||||||||||||||||||||||||||
| Mutagenesis | 1251 | 1 | D → N: Loss of endonuclease activity and nonsense-mediated RNA decay; when associated with N-1392. Ref.9 Ref.10 | |||||||||||||||||||||||||||||
| Mutagenesis | 1353 | 1 | D → A: Abolishes RNase activity. Ref.10 Ref.14 | |||||||||||||||||||||||||||||
| Mutagenesis | 1392 | 1 | D → A: Impaired nonsense-mediated RNA decay; when associated with A-1251. Ref.9 Ref.10 | |||||||||||||||||||||||||||||
| Mutagenesis | 1392 | 1 | D → N: Loss of endonuclease activity and nonsense-mediated RNA decay; when associated with N-1251. Ref.9 Ref.10 | |||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||
| Beta strand | 1240 – 1250 | 11 | ||||||||||||||||||||||||||||||
| Helix | 1252 – 1268 | 17 | ||||||||||||||||||||||||||||||
| Beta strand | 1270 – 1276 | 7 | ||||||||||||||||||||||||||||||
| Helix | 1277 – 1287 | 11 | ||||||||||||||||||||||||||||||
| Helix | 1298 – 1319 | 22 | ||||||||||||||||||||||||||||||
| Beta strand | 1325 – 1328 | 4 | ||||||||||||||||||||||||||||||
| Beta strand | 1334 – 1336 | 3 | ||||||||||||||||||||||||||||||
| Helix | 1352 – 1361 | 10 | ||||||||||||||||||||||||||||||
| Helix | 1368 – 1371 | 4 | ||||||||||||||||||||||||||||||
| Beta strand | 1381 – 1389 | 9 | ||||||||||||||||||||||||||||||
| Helix | 1393 – 1401 | 9 | ||||||||||||||||||||||||||||||
| Helix | 1409 – 1416 | 8 | ||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human homolog of yeast est1 associates with telomerase and uncaps chromosome ends when overexpressed." Reichenbach P., Hoess M., Azzalin C.M., Nabholz M., Bucher P., Lingner J. Curr. Biol. 13:568-574(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-341, FUNCTION IN TELOMERE REGULATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX. Tissue: Cervix carcinoma. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS PRO-291 AND THR-341. Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "Functional conservation of the telomerase protein Est1p in humans." Snow B.E., Erdmann N., Cruickshank J., Goldman H., Gill R.M., Robinson M.O., Harrington L. Curr. Biol. 13:698-704(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-1419 (ISOFORM 1), FUNCTION IN TELOMERE REGULATION, TISSUE SPECIFICITY, SINGLE-STRANDED TELOMERE DNA-BINDING, IDENTIFICATION IN THE TELOMERASE RIBONUCLEOPROTEIN COMPLEX, INTERACTION WITH TERT. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 888-1419 (ISOFORM 1). Tissue: Testis. |
| [7] | "Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1." Chiu S.-Y., Serin G., Ohara O., Maquat L.E. RNA 9:77-87(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PP2A CATALYTIC SUBUNITS; SMG1; UPF1; UPF2 AND UPF3B. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "SMG6 is the catalytic endonuclease that cleaves mRNAs containing nonsense codons in metazoan." Huntzinger E., Kashima I., Fauser M., Sauliere J., Izaurralde E. RNA 14:2609-2617(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, DOMAIN, MUTAGENESIS OF ASP-1251 AND ASP-1392. |
| [10] | "SMG6 promotes endonucleolytic cleavage of nonsense mRNA in human cells." Eberle A.B., Lykke-Andersen S., Muhlemann O., Jensen T.H. Nat. Struct. Mol. Biol. 16:49-55(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, DOMAIN, SUBCELLULAR LOCATION, INTERACTION WITH UPF1, MUTAGENESIS OF ASP-1251; ASP-1353 AND ASP-1392. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-479, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis." Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Science 323:644-648(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE TELOMERASE HOLOENZYME COMPLEX. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex." Glavan F., Behm-Ansmant I., Izaurralde E., Conti E. EMBO J. 25:5117-5125(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 1239-1419, FUNCTION, COFACTOR, CATALYTIC ACTIVITY, MUTAGENESIS OF ASP-1353. |
| [15] | "Crystal structure of the PIN domain of human telomerase-associated protein EST1A." Takeshita D., Zenno S., Lee W.C., Saigo K., Tanokura M. Proteins 68:980-989(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1239-1419. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY145883 mRNA. Translation: AAN46114.1. AB018275 mRNA. Translation: BAA34452.2. Different initiation. AL133597 mRNA. Translation: CAB63733.1. AY168921 mRNA. Translation: AAO17581.1. BC064916 mRNA. Translation: AAH64916.1. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00015793. IPI01012883. | ||||||||||||||||||||||||
| PIR | T43475. | ||||||||||||||||||||||||
| RefSeq | NP_001243756.1. NM_001256827.1. NP_001243757.1. NM_001256828.1. NP_060045.4. NM_017575.4. | ||||||||||||||||||||||||
| UniGene | Hs.448342. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q86US8. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q86US8. 4 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000263073. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q86US8. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 91771922. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q86US8. | ||||||||||||||||||||||||
| PRIDE | Q86US8. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 23293. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000263073; ENSP00000263073; ENSG00000070366. ENST00000544865; ENSP00000443920; ENSG00000070366. | ||||||||||||||||||||||||
| GeneID | 23293. | ||||||||||||||||||||||||
| KEGG | hsa:23293. | ||||||||||||||||||||||||
| UCSC | uc002fub.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 23293. | ||||||||||||||||||||||||
| GeneCards | GC17M001963. | ||||||||||||||||||||||||
| H-InvDB | HIX0013415. | ||||||||||||||||||||||||
| HGNC | HGNC:17809. SMG6. | ||||||||||||||||||||||||
| HPA | HPA042932. | ||||||||||||||||||||||||
| MIM | 610963. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q86US8. | ||||||||||||||||||||||||
| PharmGKB | PA25584. | ||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG313444. | ||||||||||||||||||||||||
| HOGENOM | HOG000112402. | ||||||||||||||||||||||||
| HOVERGEN | HBG051511. | ||||||||||||||||||||||||
| InParanoid | Q86US8. | ||||||||||||||||||||||||
| KO | K11124. | ||||||||||||||||||||||||
| OMA | MRNMQQQ. | ||||||||||||||||||||||||
| OrthoDB | EOG4KKZ29. | ||||||||||||||||||||||||
| PhylomeDB | Q86US8. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | telomerasepathway. Regulation of Telomerase. | ||||||||||||||||||||||||
| Reactome | REACT_21257. Metabolism of RNA. REACT_71. Gene Expression. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q86US8. | ||||||||||||||||||||||||
| Bgee | Q86US8. | ||||||||||||||||||||||||
| CleanEx | HS_SMG6. | ||||||||||||||||||||||||
| Genevestigator | Q86US8. | ||||||||||||||||||||||||
| GermOnline | ENSG00000070366. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.25.40.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR018834. DNA/RNA-bd_Est1-type. IPR019458. EST1. IPR002716. PIN_dom. IPR006596. PINc_nuc-bd. IPR011990. TPR-like_helical. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF10374. EST1. 1 hit. PF10373. EST1_DNA_bind. 1 hit. PF13638. PIN_4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00670. PINc. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | SMG6. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q86US8. | ||||||||||||||||||||||||
| GenomeRNAi | 23293. | ||||||||||||||||||||||||
| NextBio | 45116. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | EST1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86US8 Secondary accession number(s): O94837, Q86VH6, Q9UF60 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
