Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 589

Gene

ZNF589

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in hematopoietic stem/progenitor cell differentiation. May play a role as a DNA binding-dependent transcriptional repressor.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri248 – 27023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri276 – 29823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri304 – 32623C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri332 – 35423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 589
Alternative name(s):
Stem cell zinc finger protein 1
Gene namesi
Name:ZNF589
Synonyms:SZF1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:16747. ZNF589.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134988473.

Polymorphism and mutation databases

BioMutaiZNF589.
DMDMi74759403.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 364364Zinc finger protein 589PRO_0000306325Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei190 – 1901PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ86UQ0.
MaxQBiQ86UQ0.
PaxDbiQ86UQ0.
PeptideAtlasiQ86UQ0.
PRIDEiQ86UQ0.

PTM databases

iPTMnetiQ86UQ0.
PhosphoSiteiQ86UQ0.

Expressioni

Tissue specificityi

Isoform 2 is widely expressed. Isoform 3 is only expressed in CD34+ cells.1 Publication

Gene expression databases

BgeeiQ86UQ0.
CleanExiHS_ZNF589.
ExpressionAtlasiQ86UQ0. baseline and differential.
GenevisibleiQ86UQ0. HS.

Organism-specific databases

HPAiHPA003145.

Interactioni

Subunit structurei

Interacts with TRIM28.1 Publication

Protein-protein interaction databases

BioGridi119515. 4 interactions.
STRINGi9606.ENSP00000346729.

Structurei

3D structure databases

ProteinModelPortaliQ86UQ0.
SMRiQ86UQ0. Positions 216-363.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 10874KRABPROSITE-ProRule annotationAdd
BLAST

Domaini

The KRAB domain mediates interaction with TRIM28.

Sequence similaritiesi

Contains 4 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri248 – 27023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri276 – 29823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri304 – 32623C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri332 – 35423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063157.
InParanoidiQ86UQ0.
KOiK09228.
OMAiYPTFRFY.
OrthoDBiEOG7XH6PV.
PhylomeDBiQ86UQ0.
TreeFamiTF338096.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86UQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWAPREQLLG WTAEALPAKD SAWPWEEKPR YLGPVTFEDV AVLFTEAEWK
60 70 80 90 100
RLSLEQRNLY KEVMLENLRN LVSLAESKPE VHTCPSCPLA FGSQQFLSQD
110 120 130 140 150
ELHNHPIPGF HAGNQLHPGN PCPEDQPQSQ HPSDKNHRGA EAEDQRVEGG
160 170 180 190 200
VRPLFWSTNE RGALVGFSSL FQRPPISSWG GNRILEIQLS PAQNASSEEV
210 220 230 240 250
DRISKRAETP GFGAVTFGEC ALAFNQKSNL FRQKAVTAEK SSDKRQSQVC
260 270 280 290 300
RECGRGFSRK SQLIIHQRTH TGEKPYVCGE CGRGFIVESV LRNHLSTHSG
310 320 330 340 350
EKPYVCSHCG RGFSCKPYLI RHQRTHTREK SFMCTVCGRG FREKSELIKH
360
QRIHTGDKPY VCRD
Length:364
Mass (Da):41,189
Last modified:June 1, 2003 - v1
Checksum:iEC335916B88993E3
GO
Isoform 2 (identifier: Q86UQ0-2) [UniParc]FASTAAdd to basket

Also known as: SZF1-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MWAPREQLLGWTAEALPAKDSAWPWEEKPRYL → MIDFQMLNQLCRTIINPSVIPCLKYCGDQI
     75-75: Missing.

Note: Probable target of nonsense-mediated mRNA decay. The proposed CDS is dubious.
Show »
Length:361
Mass (Da):40,762
Checksum:iFA44D5AA4E7C2EBD
GO
Isoform 3 (identifier: Q86UQ0-3) [UniParc]FASTAAdd to basket

Also known as: SZF1-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MWAPREQLLGWTAEALPAKDSAWPWEEKPRYL → MIDFQMLNQLCRTIINPSVIPCLKYCGDQI
     75-75: Missing.
     353-364: IHTGDKPYVCRD → CQVTVPLEEW...LRDTFTRSPS

Note: Probable target of nonsense-mediated mRNA decay. The proposed CDS is dubious. Isoform produced through aberrant splice sites.
Show »
Length:421
Mass (Da):47,760
Checksum:i9BAAE99B983B1D14
GO

Sequence cautioni

The sequence AAH05859.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH06247.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAH48798.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121T → A.1 Publication
Corresponds to variant rs9847953 [ dbSNP | Ensembl ].
VAR_052871
Natural varianti216 – 2161T → R.2 Publications
Corresponds to variant rs11718329 [ dbSNP | Ensembl ].
VAR_035290

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MWAPR…KPRYL → MIDFQMLNQLCRTIINPSVI PCLKYCGDQI in isoform 2 and isoform 3. 1 PublicationVSP_028449Add
BLAST
Alternative sequencei75 – 751Missing in isoform 2 and isoform 3. 1 PublicationVSP_028450
Alternative sequencei353 – 36412IHTGD…YVCRD → CQVTVPLEEWSLHLTTSFCN CVLPLASMTLSCFIFFYISS LCCFLSYPTFRFYSEFSLQP YNLRDTFTRSPS in isoform 3. 1 PublicationVSP_028451Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114816 mRNA. Translation: AAD38879.1.
AF114817 mRNA. Translation: AAD38880.1.
AY258146 mRNA. Translation: AAP14679.1.
AL832831 mRNA. Translation: CAI46129.1.
CH471055 Genomic DNA. Translation: EAW64856.1.
BC005859 mRNA. Translation: AAH05859.2. Different initiation.
BC006247 mRNA. Translation: AAH06247.2. Different initiation.
BC048798 mRNA. Translation: AAH48798.1. Different initiation.
CCDSiCCDS43085.1. [Q86UQ0-1]
RefSeqiNP_057173.2. NM_016089.2. [Q86UQ0-1]
UniGeneiHs.172602.

Genome annotation databases

EnsembliENST00000354698; ENSP00000346729; ENSG00000164048. [Q86UQ0-1]
ENST00000448461; ENSP00000404592; ENSG00000164048. [Q86UQ0-1]
GeneIDi51385.
KEGGihsa:51385.
UCSCiuc003csl.5. human. [Q86UQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114816 mRNA. Translation: AAD38879.1.
AF114817 mRNA. Translation: AAD38880.1.
AY258146 mRNA. Translation: AAP14679.1.
AL832831 mRNA. Translation: CAI46129.1.
CH471055 Genomic DNA. Translation: EAW64856.1.
BC005859 mRNA. Translation: AAH05859.2. Different initiation.
BC006247 mRNA. Translation: AAH06247.2. Different initiation.
BC048798 mRNA. Translation: AAH48798.1. Different initiation.
CCDSiCCDS43085.1. [Q86UQ0-1]
RefSeqiNP_057173.2. NM_016089.2. [Q86UQ0-1]
UniGeneiHs.172602.

3D structure databases

ProteinModelPortaliQ86UQ0.
SMRiQ86UQ0. Positions 216-363.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119515. 4 interactions.
STRINGi9606.ENSP00000346729.

PTM databases

iPTMnetiQ86UQ0.
PhosphoSiteiQ86UQ0.

Polymorphism and mutation databases

BioMutaiZNF589.
DMDMi74759403.

Proteomic databases

EPDiQ86UQ0.
MaxQBiQ86UQ0.
PaxDbiQ86UQ0.
PeptideAtlasiQ86UQ0.
PRIDEiQ86UQ0.

Protocols and materials databases

DNASUi51385.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354698; ENSP00000346729; ENSG00000164048. [Q86UQ0-1]
ENST00000448461; ENSP00000404592; ENSG00000164048. [Q86UQ0-1]
GeneIDi51385.
KEGGihsa:51385.
UCSCiuc003csl.5. human. [Q86UQ0-1]

Organism-specific databases

CTDi51385.
GeneCardsiZNF589.
HGNCiHGNC:16747. ZNF589.
HPAiHPA003145.
MIMi616702. gene.
neXtProtiNX_Q86UQ0.
PharmGKBiPA134988473.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063157.
InParanoidiQ86UQ0.
KOiK09228.
OMAiYPTFRFY.
OrthoDBiEOG7XH6PV.
PhylomeDBiQ86UQ0.
TreeFamiTF338096.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF589. human.
GenomeRNAii51385.
PROiQ86UQ0.
SOURCEiSearch...

Gene expression databases

BgeeiQ86UQ0.
CleanExiHS_ZNF589.
ExpressionAtlasiQ86UQ0. baseline and differential.
GenevisibleiQ86UQ0. HS.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "SZF1: a novel KRAB-zinc finger gene expressed in CD34+ stem/progenitor cells."
    Liu C., Levenstein M., Chen J., Tsifrina E., Yonescu R., Griffin C., Civin C.I., Small D.
    Exp. Hematol. 27:313-325(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-216.
  2. "Cloning and characterization of a novel KRAB-zinc finger protein."
    Shan Y.X., Yu L.
    Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lymph node.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ALA-12 AND ARG-216.
    Tissue: Eye, Lung and Muscle.
  6. "A common DNA-binding site for SZF1 and the BRCA1-associated zinc finger protein, ZBRK1."
    Peng H., Zheng L., Lee W.H., Rux J.J., Rauscher F.J. III
    Cancer Res. 62:3773-3781(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRIM28, FUNCTION.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-190, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1."
    Wang W., Cai J., Wu Y., Hu L., Chen Z., Hu J., Chen Z., Li W., Guo M., Huang Z.
    Cell. Mol. Life Sci. 70:3947-3958(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiZN589_HUMAN
AccessioniPrimary (citable) accession number: Q86UQ0
Secondary accession number(s): Q86UC9
, Q9BRI6, Q9BRY3, Q9Y611, Q9Y612
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: June 1, 2003
Last modified: July 6, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.