Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 589

Gene

ZNF589

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in hematopoietic stem/progenitor cell differentiation. May play a role as a DNA binding-dependent transcriptional repressor.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri248 – 270C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri276 – 298C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • negative regulation of transcription by RNA polymerase II Source: NTNU_SB

Keywordsi

Molecular functionDNA-binding, Repressor
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 589
Alternative name(s):
Stem cell zinc finger protein 1
Gene namesi
Name:ZNF589
Synonyms:SZF1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000164048.13
HGNCiHGNC:16747 ZNF589
MIMi616702 gene
neXtProtiNX_Q86UQ0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51385
OpenTargetsiENSG00000164048
PharmGKBiPA134988473

Polymorphism and mutation databases

BioMutaiZNF589
DMDMi74759403

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003063251 – 364Zinc finger protein 589Add BLAST364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei190PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ86UQ0
MaxQBiQ86UQ0
PaxDbiQ86UQ0
PeptideAtlasiQ86UQ0
PRIDEiQ86UQ0

PTM databases

iPTMnetiQ86UQ0
PhosphoSitePlusiQ86UQ0

Expressioni

Tissue specificityi

Isoform 2 is widely expressed. Isoform 3 is only expressed in CD34+ cells.1 Publication

Gene expression databases

BgeeiENSG00000164048
CleanExiHS_ZNF589
ExpressionAtlasiQ86UQ0 baseline and differential
GenevisibleiQ86UQ0 HS

Organism-specific databases

HPAiHPA003145

Interactioni

Subunit structurei

Interacts with TRIM28.1 Publication

Protein-protein interaction databases

BioGridi119515, 5 interactors
STRINGi9606.ENSP00000346729

Structurei

3D structure databases

ProteinModelPortaliQ86UQ0
SMRiQ86UQ0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 108KRABPROSITE-ProRule annotationAdd BLAST74

Domaini

The KRAB domain mediates interaction with TRIM28.

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri248 – 270C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri276 – 298C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 4PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00530000063157
InParanoidiQ86UQ0
KOiK09228
OMAiYPTFRFY
OrthoDBiEOG091G02KC
PhylomeDBiQ86UQ0
TreeFamiTF338096

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86UQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWAPREQLLG WTAEALPAKD SAWPWEEKPR YLGPVTFEDV AVLFTEAEWK
60 70 80 90 100
RLSLEQRNLY KEVMLENLRN LVSLAESKPE VHTCPSCPLA FGSQQFLSQD
110 120 130 140 150
ELHNHPIPGF HAGNQLHPGN PCPEDQPQSQ HPSDKNHRGA EAEDQRVEGG
160 170 180 190 200
VRPLFWSTNE RGALVGFSSL FQRPPISSWG GNRILEIQLS PAQNASSEEV
210 220 230 240 250
DRISKRAETP GFGAVTFGEC ALAFNQKSNL FRQKAVTAEK SSDKRQSQVC
260 270 280 290 300
RECGRGFSRK SQLIIHQRTH TGEKPYVCGE CGRGFIVESV LRNHLSTHSG
310 320 330 340 350
EKPYVCSHCG RGFSCKPYLI RHQRTHTREK SFMCTVCGRG FREKSELIKH
360
QRIHTGDKPY VCRD
Length:364
Mass (Da):41,189
Last modified:June 1, 2003 - v1
Checksum:iEC335916B88993E3
GO
Isoform 2 (identifier: Q86UQ0-2) [UniParc]FASTAAdd to basket
Also known as: SZF1-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MWAPREQLLGWTAEALPAKDSAWPWEEKPRYL → MIDFQMLNQLCRTIINPSVIPCLKYCGDQI
     75-75: Missing.

Note: Probable target of nonsense-mediated mRNA decay. The proposed CDS is dubious.
Show »
Length:361
Mass (Da):40,762
Checksum:iFA44D5AA4E7C2EBD
GO
Isoform 3 (identifier: Q86UQ0-3) [UniParc]FASTAAdd to basket
Also known as: SZF1-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MWAPREQLLGWTAEALPAKDSAWPWEEKPRYL → MIDFQMLNQLCRTIINPSVIPCLKYCGDQI
     75-75: Missing.
     353-364: IHTGDKPYVCRD → CQVTVPLEEW...LRDTFTRSPS

Note: Probable target of nonsense-mediated mRNA decay. The proposed CDS is dubious. Isoform produced through aberrant splice sites.
Show »
Length:421
Mass (Da):47,760
Checksum:i9BAAE99B983B1D14
GO

Sequence cautioni

The sequence AAH05859 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH06247 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH48798 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05287112T → A1 PublicationCorresponds to variant dbSNP:rs9847953Ensembl.1
Natural variantiVAR_035290216T → R2 PublicationsCorresponds to variant dbSNP:rs11718329Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0284491 – 32MWAPR…KPRYL → MIDFQMLNQLCRTIINPSVI PCLKYCGDQI in isoform 2 and isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_02845075Missing in isoform 2 and isoform 3. 1 Publication1
Alternative sequenceiVSP_028451353 – 364IHTGD…YVCRD → CQVTVPLEEWSLHLTTSFCN CVLPLASMTLSCFIFFYISS LCCFLSYPTFRFYSEFSLQP YNLRDTFTRSPS in isoform 3. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114816 mRNA Translation: AAD38879.1
AF114817 mRNA Translation: AAD38880.1
AY258146 mRNA Translation: AAP14679.1
AL832831 mRNA Translation: CAI46129.1
CH471055 Genomic DNA Translation: EAW64856.1
BC005859 mRNA Translation: AAH05859.2 Different initiation.
BC006247 mRNA Translation: AAH06247.2 Different initiation.
BC048798 mRNA Translation: AAH48798.1 Different initiation.
CCDSiCCDS43085.1 [Q86UQ0-1]
RefSeqiNP_057173.2, NM_016089.2 [Q86UQ0-1]
UniGeneiHs.172602

Genome annotation databases

EnsembliENST00000354698; ENSP00000346729; ENSG00000164048 [Q86UQ0-1]
ENST00000448461; ENSP00000404592; ENSG00000164048 [Q86UQ0-1]
GeneIDi51385
KEGGihsa:51385
UCSCiuc003csl.5 human [Q86UQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN589_HUMAN
AccessioniPrimary (citable) accession number: Q86UQ0
Secondary accession number(s): Q86UC9
, Q9BRI6, Q9BRY3, Q9Y611, Q9Y612
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: June 1, 2003
Last modified: May 23, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health