Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 598

Gene

ZNF598

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri29 – 6941RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 21024C2H2-typeAdd
BLAST

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 598
Gene namesi
Name:ZNF598
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28079. ZNF598.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134944505.

Polymorphism and mutation databases

DMDMi74727495.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 904904Zinc finger protein 598PRO_0000250568Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei306 – 3061PhosphotyrosineCombined sources
Modified residuei437 – 4371PhosphoserineCombined sources
Isoform 2 (identifier: Q86UK7-2)
Modified residuei428 – 4281PhosphoserineCombined sources
Isoform 3 (identifier: Q86UK7-3)
Modified residuei431 – 4311PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ86UK7.
MaxQBiQ86UK7.
PaxDbiQ86UK7.
PRIDEiQ86UK7.

PTM databases

iPTMnetiQ86UK7.
PhosphoSiteiQ86UK7.

Expressioni

Gene expression databases

BgeeiQ86UK7.
CleanExiHS_ZNF598.
ExpressionAtlasiQ86UK7. baseline and differential.
GenevisibleiQ86UK7. HS.

Organism-specific databases

HPAiHPA041760.
HPA041896.

Interactioni

Protein-protein interaction databases

BioGridi124771. 31 interactions.
IntActiQ86UK7. 17 interactions.
MINTiMINT-4776754.
STRINGi9606.ENSP00000411409.

Structurei

3D structure databases

ProteinModelPortaliQ86UK7.
SMRiQ86UK7. Positions 24-75.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi598 – 744147Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2H2-type zinc finger.Curated
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri29 – 6941RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri187 – 21024C2H2-typeAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG2231. Eukaryota.
COG5236. LUCA.
HOGENOMiHOG000082533.
HOVERGENiHBG055813.
InParanoidiQ86UK7.
OrthoDBiEOG70087J.
PhylomeDBiQ86UK7.
TreeFamiTF316196.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86UK7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGGAEGR RAALEAAAAA APERGGGSCV LCCGDLEATA LGRCDHPVCY
60 70 80 90 100
RCSTKMRVLC EQRYCAVCRE ELRQVVFGKK LPAFATIPIH QLQHEKKYDI
110 120 130 140 150
YFADGKVYAL YRQLLQHECP RCPELPPFSL FGDLEQHMRR QHELFCCRLC
160 170 180 190 200
LQHLQIFTYE RKWYSRKDLA RHRMQGDPDD TSHRGHPLCK FCDERYLDND
210 220 230 240 250
ELLKHLRRDH YFCHFCDSDG AQDYYSDYAY LREHFREKHF LCEEGRCSTE
260 270 280 290 300
QFTHAFRTEI DLKAHRTACH SRSRAEARQN RHIDLQFSYA PRHSRRNEGV
310 320 330 340 350
VGGEDYEEVD RYSRQGRVAR AGTRGAQQSR RGSWRYKREE EDREVAAAVR
360 370 380 390 400
ASVAAQQQEE ARRSEDQEEG GRPKKEEAAA RGPEDPRGPR RSPRTQGEGP
410 420 430 440 450
GPKETSTNGP VSQEAFSVTG PAAPGCVGVP GALPPPSPKL KDEDFPSLSA
460 470 480 490 500
STSSSCSTAA TPGPVGLALP YAIPARGRSA FQEEDFPALV SSVPKPGTAP
510 520 530 540 550
TSLVSAWNSS SSSKKVAQPP LSAQATGSGQ PTRKAGKGSR GGRKGGPPFT
560 570 580 590 600
QEEEEDGGPA LQELLSTRPT GSVSSTLGLA SIQPSKVGKK KKVGSEKPGT
610 620 630 640 650
TLPQPPPATC PPGALQAPEA PASRAEGPVA VVVNGHTEGP APARSAPKEP
660 670 680 690 700
PGLPRPLGSF PCPTPQEDFP ALGGPCPPRM PPPPGFSAVV LLKGTPPPPP
710 720 730 740 750
PGLVPPISKP PPGFSGLLPS PHPACVPSPA TTTTTKAPRL LPAPRAYLVP
760 770 780 790 800
ENFRERNLQL IQSIRDFLQS DEARFSEFKS HSGEFRQGLI SAAQYYKSCR
810 820 830 840 850
DLLGENFQKV FNELLVLLPD TAKQQELLSA HTDFCNREKP LSTKSKKNKK
860 870 880 890 900
SAWQATTQQA GLDCRVCPTC QQVLAHGDAS SHQALHAARD DDFPSLQAIA

RIIT
Length:904
Mass (Da):98,637
Last modified:June 1, 2003 - v1
Checksum:i492F67EE4E334743
GO
Isoform 2 (identifier: Q86UK7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-337: Missing.
     424-429: Missing.
     551-551: Q → QE

Note: No experimental confirmation available.Combined sources
Show »
Length:896
Mass (Da):97,806
Checksum:i0524BC8755C1B28D
GO
Isoform 3 (identifier: Q86UK7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:898
Mass (Da):98,124
Checksum:i1C24E53E1A3573CF
GO
Isoform 4 (identifier: Q86UK7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-397: Missing.
     398-431: EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPG → MVGGCGQPQVGAGRAGMEPRGLIAVDQLCFPAPS
     551-551: Q → QE
     738-904: Missing.

Note: No experimental confirmation available.
Show »
Length:341
Mass (Da):34,010
Checksum:iABB2FDC981BB27EC
GO

Sequence cautioni

The sequence BAB15777.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti453 – 4531S → Y.2 Publications
Corresponds to variant rs11556528 [ dbSNP | Ensembl ].
VAR_034470
Natural varianti608 – 6081A → T.2 Publications
Corresponds to variant rs11248905 [ dbSNP | Ensembl ].
VAR_059818
Natural varianti637 – 6371T → M.2 Publications
Corresponds to variant rs2286469 [ dbSNP | Ensembl ].
VAR_052147
Natural varianti725 – 7251C → S.1 Publication
Corresponds to variant rs2286468 [ dbSNP | Ensembl ].
VAR_034471

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 397397Missing in isoform 4. 1 PublicationVSP_020660Add
BLAST
Alternative sequencei335 – 3373Missing in isoform 2. 1 PublicationVSP_020661
Alternative sequencei398 – 43134EGPGP…VGVPG → MVGGCGQPQVGAGRAGMEPR GLIAVDQLCFPAPS in isoform 4. 1 PublicationVSP_020662Add
BLAST
Alternative sequencei424 – 4296Missing in isoform 2 and isoform 3. 2 PublicationsVSP_020663
Alternative sequencei551 – 5511Q → QE in isoform 2 and isoform 4. 2 PublicationsVSP_020664
Alternative sequencei738 – 904167Missing in isoform 4. 1 PublicationVSP_020665Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024487 mRNA. Translation: BAB15777.1. Different initiation.
BC010990 mRNA. Translation: AAH10990.2.
BC041015 mRNA. Translation: AAH41015.1.
BC050477 mRNA. Translation: AAH50477.1.
AL834428 mRNA. Translation: CAD39089.1.
RefSeqiNP_835461.2. NM_178167.3.
UniGeneiHs.343828.

Genome annotation databases

EnsembliENST00000431526; ENSP00000411409; ENSG00000167962.
GeneIDi90850.
KEGGihsa:90850.
UCSCiuc002cof.3. human. [Q86UK7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024487 mRNA. Translation: BAB15777.1. Different initiation.
BC010990 mRNA. Translation: AAH10990.2.
BC041015 mRNA. Translation: AAH41015.1.
BC050477 mRNA. Translation: AAH50477.1.
AL834428 mRNA. Translation: CAD39089.1.
RefSeqiNP_835461.2. NM_178167.3.
UniGeneiHs.343828.

3D structure databases

ProteinModelPortaliQ86UK7.
SMRiQ86UK7. Positions 24-75.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124771. 31 interactions.
IntActiQ86UK7. 17 interactions.
MINTiMINT-4776754.
STRINGi9606.ENSP00000411409.

PTM databases

iPTMnetiQ86UK7.
PhosphoSiteiQ86UK7.

Polymorphism and mutation databases

DMDMi74727495.

Proteomic databases

EPDiQ86UK7.
MaxQBiQ86UK7.
PaxDbiQ86UK7.
PRIDEiQ86UK7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000431526; ENSP00000411409; ENSG00000167962.
GeneIDi90850.
KEGGihsa:90850.
UCSCiuc002cof.3. human. [Q86UK7-1]

Organism-specific databases

CTDi90850.
GeneCardsiZNF598.
HGNCiHGNC:28079. ZNF598.
HPAiHPA041760.
HPA041896.
neXtProtiNX_Q86UK7.
PharmGKBiPA134944505.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2231. Eukaryota.
COG5236. LUCA.
HOGENOMiHOG000082533.
HOVERGENiHBG055813.
InParanoidiQ86UK7.
OrthoDBiEOG70087J.
PhylomeDBiQ86UK7.
TreeFamiTF316196.

Miscellaneous databases

GenomeRNAii90850.
PROiQ86UK7.

Gene expression databases

BgeeiQ86UK7.
CleanExiHS_ZNF598.
ExpressionAtlasiQ86UK7. baseline and differential.
GenevisibleiQ86UK7. HS.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANTS TYR-453; THR-608 AND MET-637.
    Tissue: Spleen.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 236-904 (ISOFORM 2), VARIANTS TYR-453; THR-608 AND MET-637.
    Tissue: Lung and Skin.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 376-904 (ISOFORM 3), VARIANT SER-725.
    Tissue: Melanoma.
  4. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
    Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
    Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-306, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-437, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-428 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-431 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-428 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-431 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiZN598_HUMAN
AccessioniPrimary (citable) accession number: Q86UK7
Secondary accession number(s): Q8IW49
, Q8N3D9, Q96FG3, Q9H7J3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: June 1, 2003
Last modified: June 8, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.