Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L52, mitochondrial

Gene

MRPL52

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286. Mitochondrial translation initiation.
R-HSA-5389840. Mitochondrial translation elongation.
R-HSA-5419276. Mitochondrial translation termination.

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L52, mitochondrial
Short name:
L52mt
Short name:
MRP-L52
Gene namesi
Name:MRPL52
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:16655. MRPL52.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000172590.
PharmGKBiPA30985.

Polymorphism and mutation databases

BioMutaiMRPL52.
DMDMi124053357.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 23MitochondrionSequence analysisAdd BLAST23
ChainiPRO_000027309324 – 12339S ribosomal protein L52, mitochondrialAdd BLAST100

Proteomic databases

EPDiQ86TS9.
MaxQBiQ86TS9.
PaxDbiQ86TS9.
PeptideAtlasiQ86TS9.
PRIDEiQ86TS9.
TopDownProteomicsiQ86TS9-1. [Q86TS9-1]
Q86TS9-3. [Q86TS9-3]

PTM databases

iPTMnetiQ86TS9.
PhosphoSitePlusiQ86TS9.

Expressioni

Gene expression databases

BgeeiENSG00000172590.
CleanExiHS_MRPL52.
ExpressionAtlasiQ86TS9. baseline and differential.
GenevisibleiQ86TS9. HS.

Organism-specific databases

HPAiHPA012319.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.1 Publication

Protein-protein interaction databases

BioGridi125788. 36 interactors.
IntActiQ86TS9. 6 interactors.
STRINGi9606.ENSP00000347277.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40j6-123[»]
ProteinModelPortaliQ86TS9.
SMRiQ86TS9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiENOG410J2WG. Eukaryota.
ENOG4111XV4. LUCA.
GeneTreeiENSGT00390000005763.
HOGENOMiHOG000293349.
HOVERGENiHBG093902.
InParanoidiQ86TS9.
KOiK17433.
OMAiWQLRQQE.
OrthoDBiEOG091G0YE9.
PhylomeDBiQ86TS9.
TreeFamiTF323872.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86TS9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALGTVLFT GVRRLHCSVA AWAGGQWRLQ QGLAANPSGY GPLTELPDWS
60 70 80 90 100
YADGRPAPPM KGQLRRKAER ETFARRVVLL SQEMDAGLQA WQLRQQKLQE
110 120
EQRKQENALK PKGASLKSPL PSQ
Length:123
Mass (Da):13,664
Last modified:January 23, 2007 - v2
Checksum:iA67803930E27E4EE
GO
Isoform 2 (identifier: Q86TS9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: Missing.

Note: No experimental confirmation available.
Show »
Length:64
Mass (Da):7,445
Checksum:i0BD9266F245EDB32
GO
Isoform 3 (identifier: Q86TS9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-11: TG → S

Show »
Length:122
Mass (Da):13,593
Checksum:i3EF83F97831296C2
GO
Isoform 4 (identifier: Q86TS9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-87: DGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAG → ETSCTAVTGNGRWITSMAAQAAEVAGRTKEAGKCS
     88-123: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:87
Mass (Da):9,072
Checksum:i284DA893B5DDB588
GO

Sequence cautioni

The sequence CAD66556 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49W → C in AAH68070 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0300805G → V.Corresponds to variant rs1135641dbSNPEnsembl.1
Natural variantiVAR_03008119V → A.2 PublicationsCorresponds to variant rs4982685dbSNPEnsembl.1
Natural variantiVAR_052044104K → R.Corresponds to variant rs11538931dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445601 – 59Missing in isoform 2. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_04524210 – 11TG → S in isoform 3. 1 Publication2
Alternative sequenceiVSP_05409453 – 87DGRPA…EMDAG → ETSCTAVTGNGRWITSMAAQ AAEVAGRTKEAGKCS in isoform 4. CuratedAdd BLAST35
Alternative sequenceiVSP_05409588 – 123Missing in isoform 4. CuratedAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DW429620 mRNA. No translation available.
BX248749 mRNA. Translation: CAD66556.1. Different initiation.
AL135998 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66238.1.
CH471078 Genomic DNA. Translation: EAW66240.1.
CH471078 Genomic DNA. Translation: EAW66241.1.
CH471078 Genomic DNA. Translation: EAW66242.1.
CH471078 Genomic DNA. Translation: EAW66244.1.
BC068070 mRNA. Translation: AAH68070.1.
BU600884 mRNA. No translation available.
CCDSiCCDS41917.1. [Q86TS9-1]
CCDS41918.1. [Q86TS9-2]
CCDS9575.1. [Q86TS9-3]
CCDS9576.1. [Q86TS9-4]
RefSeqiNP_848026.1. NM_178336.2. [Q86TS9-1]
NP_851313.1. NM_180982.2. [Q86TS9-3]
NP_851821.1. NM_181304.2. [Q86TS9-2]
NP_851822.1. NM_181305.2. [Q86TS9-2]
NP_851823.1. NM_181306.2. [Q86TS9-2]
NP_851824.1. NM_181307.2. [Q86TS9-4]
XP_005267385.1. XM_005267328.3. [Q86TS9-2]
UniGeneiHs.355935.

Genome annotation databases

EnsembliENST00000355151; ENSP00000347277; ENSG00000172590. [Q86TS9-1]
ENST00000397496; ENSP00000380633; ENSG00000172590. [Q86TS9-3]
ENST00000397505; ENSP00000380642; ENSG00000172590. [Q86TS9-4]
ENST00000553711; ENSP00000451303; ENSG00000172590. [Q86TS9-2]
ENST00000555345; ENSP00000451081; ENSG00000172590. [Q86TS9-2]
ENST00000556840; ENSP00000451481; ENSG00000172590. [Q86TS9-2]
GeneIDi122704.
KEGGihsa:122704.
UCSCiuc001wgw.4. human. [Q86TS9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DW429620 mRNA. No translation available.
BX248749 mRNA. Translation: CAD66556.1. Different initiation.
AL135998 Genomic DNA. No translation available.
CH471078 Genomic DNA. Translation: EAW66238.1.
CH471078 Genomic DNA. Translation: EAW66240.1.
CH471078 Genomic DNA. Translation: EAW66241.1.
CH471078 Genomic DNA. Translation: EAW66242.1.
CH471078 Genomic DNA. Translation: EAW66244.1.
BC068070 mRNA. Translation: AAH68070.1.
BU600884 mRNA. No translation available.
CCDSiCCDS41917.1. [Q86TS9-1]
CCDS41918.1. [Q86TS9-2]
CCDS9575.1. [Q86TS9-3]
CCDS9576.1. [Q86TS9-4]
RefSeqiNP_848026.1. NM_178336.2. [Q86TS9-1]
NP_851313.1. NM_180982.2. [Q86TS9-3]
NP_851821.1. NM_181304.2. [Q86TS9-2]
NP_851822.1. NM_181305.2. [Q86TS9-2]
NP_851823.1. NM_181306.2. [Q86TS9-2]
NP_851824.1. NM_181307.2. [Q86TS9-4]
XP_005267385.1. XM_005267328.3. [Q86TS9-2]
UniGeneiHs.355935.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40j6-123[»]
ProteinModelPortaliQ86TS9.
SMRiQ86TS9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125788. 36 interactors.
IntActiQ86TS9. 6 interactors.
STRINGi9606.ENSP00000347277.

PTM databases

iPTMnetiQ86TS9.
PhosphoSitePlusiQ86TS9.

Polymorphism and mutation databases

BioMutaiMRPL52.
DMDMi124053357.

Proteomic databases

EPDiQ86TS9.
MaxQBiQ86TS9.
PaxDbiQ86TS9.
PeptideAtlasiQ86TS9.
PRIDEiQ86TS9.
TopDownProteomicsiQ86TS9-1. [Q86TS9-1]
Q86TS9-3. [Q86TS9-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355151; ENSP00000347277; ENSG00000172590. [Q86TS9-1]
ENST00000397496; ENSP00000380633; ENSG00000172590. [Q86TS9-3]
ENST00000397505; ENSP00000380642; ENSG00000172590. [Q86TS9-4]
ENST00000553711; ENSP00000451303; ENSG00000172590. [Q86TS9-2]
ENST00000555345; ENSP00000451081; ENSG00000172590. [Q86TS9-2]
ENST00000556840; ENSP00000451481; ENSG00000172590. [Q86TS9-2]
GeneIDi122704.
KEGGihsa:122704.
UCSCiuc001wgw.4. human. [Q86TS9-1]

Organism-specific databases

CTDi122704.
GeneCardsiMRPL52.
HGNCiHGNC:16655. MRPL52.
HPAiHPA012319.
MIMi611856. gene.
neXtProtiNX_Q86TS9.
OpenTargetsiENSG00000172590.
PharmGKBiPA30985.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2WG. Eukaryota.
ENOG4111XV4. LUCA.
GeneTreeiENSGT00390000005763.
HOGENOMiHOG000293349.
HOVERGENiHBG093902.
InParanoidiQ86TS9.
KOiK17433.
OMAiWQLRQQE.
OrthoDBiEOG091G0YE9.
PhylomeDBiQ86TS9.
TreeFamiTF323872.

Enzyme and pathway databases

ReactomeiR-HSA-5368286. Mitochondrial translation initiation.
R-HSA-5389840. Mitochondrial translation elongation.
R-HSA-5419276. Mitochondrial translation termination.

Miscellaneous databases

ChiTaRSiMRPL52. human.
GenomeRNAii122704.
PROiQ86TS9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172590.
CleanExiHS_MRPL52.
ExpressionAtlasiQ86TS9. baseline and differential.
GenevisibleiQ86TS9. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiRM52_HUMAN
AccessioniPrimary (citable) accession number: Q86TS9
Secondary accession number(s): A6NMQ8
, A8MXK5, A8MYI6, G3XCN9, Q6NVH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.