Q86TP1 (PRUNE_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein prune homolog Short name=hPrune EC=3.6.1.1 Alternative name(s): Drosophila-related expressed sequence 17 Short name=DRES-17 Short name=DRES17 HTcD37 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 453 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1. Ref.1 Ref.9 Ref.10 Ref.12 Ref.14 |
| Catalytic activity | Diphosphate + H2O = 2 phosphate. |
| Cofactor | Binds 2 manganese ions per subunit By similarity. |
| Enzyme regulation | Activated by magnesium ions and inhibited by manganese ions. Inhibited by dipyridamole, moderately sensitive to IBMX and inhibited by vinpocetine. Ref.10 |
| Subunit structure | Homooligomer. Able to homodimerize via its C-terminal domain. Interacts with NME1. Interacts with GSK3; at focal adhesion complexes where paxillin and vinculin are colocalized. Ref.1 Ref.10 Ref.12 Ref.13 Ref.14 |
| Subcellular location | Cytoplasm. Nucleus. Cell junction › focal adhesion. Note: In some transfected cells a nuclear staining is also observed. Ref.1 Ref.11 Ref.12 |
| Tissue specificity | Ubiquitously expressed. Seems to be overexpressed in aggressive sarcoma subtypes, such as leiomyosarcomas and malignant fibrous histiocytomas (MFH) as well as in the less malignant liposarcomas. Ref.1 Ref.9 Ref.11 |
| Sequence similarities | Belongs to the PPase class C family. Prune subfamily. |
| Biophysicochemical properties | Kinetic parameters: KM=0.91 µM for cAMP Ref.10 Ref.13 KM=2.3 µM for cGMP Vmax=12.8 pmol/min/µg enzyme with cAMP as substrate Vmax=0.8 pmol/min/µg enzyme with cGMP as substrate |
| Sequence caution | The sequence BAB55423.1 differs from that shown. Reason: Erroneous initiation. The sequence BAG60534.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Manganese Metal-binding |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA focal adhesionInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | inorganic diphosphatase activity Inferred from electronic annotation. Source: EC manganese ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NME1 | P15531 | 2 | EBI-2127112,EBI-741141 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86TP1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86TP1-2) The sequence of this isoform differs from the canonical sequence as follows: 45-112: TTEAEEVFVPVLNIKRSELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSK → A | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86TP1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-182: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q86TP1-4) The sequence of this isoform differs from the canonical sequence as follows: 15-174: Missing. 259-311: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q86TP1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-182: Missing. 259-311: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q86TP1-6) The sequence of this isoform differs from the canonical sequence as follows: 1-232: Missing. 259-311: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q86TP1-7) The sequence of this isoform differs from the canonical sequence as follows: 1-232: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 453 | 453 | Protein prune homolog | PRO_0000337987 | |||||
Regions | |||||||||
| Region | 393 – 420 | 28 | Essential for homodimerization | ||||||
| Motif | 106 – 108 | 3 | DHH motif | ||||||
Sites | |||||||||
| Metal binding | 28 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 30 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 106 | 1 | Manganese 1 By similarity | ||||||
| Metal binding | 106 | 1 | Manganese 2 By similarity | ||||||
| Metal binding | 179 | 1 | Manganese 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 232 | 232 | Missing in isoform 6 and isoform 7. | VSP_034013 | |||||
| Alternative sequence | 1 – 182 | 182 | Missing in isoform 3 and isoform 5. | VSP_034014 | |||||
| Alternative sequence | 15 – 174 | 160 | Missing in isoform 4. | VSP_034015 | |||||
| Alternative sequence | 45 – 112 | 68 | TTEAE…HILSK → A in isoform 2. | VSP_034016 | |||||
| Alternative sequence | 259 – 311 | 53 | Missing in isoform 4, isoform 5 and isoform 6. | VSP_034017 | |||||
| Natural variant | 397 | 1 | G → R. Corresponds to variant rs3738477 [ dbSNP | Ensembl ]. | VAR_059559 | |||||
| Natural variant | 397 | 1 | G → S. Corresponds to variant rs3738477 [ dbSNP | Ensembl ]. | VAR_043728 | |||||
Experimental info | |||||||||
| Mutagenesis | 28 | 1 | D → A: Partial loss of cAMP PDE activity. Partial loss of cAMP PDE activity; when associated with D-106. Partial loss of cAMP PDE activity; when associated with D-106 and D-179. Ref.10 | ||||||
| Mutagenesis | 106 | 1 | D → A: No change in cAMP PDE activity. Partial loss of cAMP PDE activity; when associated with D-28. Partial loss of cAMP PDE activity; when associated with D-28 and D-179. Ref.10 | ||||||
| Mutagenesis | 126 – 129 | 4 | DHRP → AAAA: Partial loss of cAMP PDE activity. Ref.10 | ||||||
| Mutagenesis | 179 | 1 | D → A: Partial loss of cAMP PDE activity. Partial loss of cAMP PDE activity; when associated with D-28 and D-106. Ref.10 | ||||||
| Sequence conflict | 14 | 1 | E → A in AAK00592. Ref.2 | ||||||
| Sequence conflict | 19 – 22 | 4 | HVVL → AWHE in AAF04914. Ref.7 | ||||||
| Sequence conflict | 221 | 1 | A → V in AAC95290. Ref.1 | ||||||
| Sequence conflict | 221 | 1 | A → V in AAF04914. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Evidence for interaction between human PRUNE and nm23-H1 NDPKinase." Reymond A., Volorio S., Merla G., Al-Maghtheh M., Zuffardi O., Bulfone A., Ballabio A., Zollo M. Oncogene 18:7244-7252(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INTERACTION WITH NME1, SUBCELLULAR LOCATION, FUNCTION. |
| [2] | "Human Prune homolog." Zollo M., Volorio S. Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 211-453 (ISOFORMS 1/3). Tissue: Brain cortex, Kidney and Thyroid. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 6). Tissue: Blood and Brain. |
| [7] | "Sequencing analysis of forty-eight human image cDNA clones similar to Drosophila mutant protein." Volorio S., Simon G., Repetto M., Cucciardi M., Banfi S., Borsani G., Ballabio A., Zollo M. DNA Seq. 9:307-315(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-453 (ISOFORM 1). Tissue: Brain. |
| [8] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 368-453 (ISOFORMS 1/2/3/4/5/6/7). Tissue: Testis. |
| [9] | "Amplification and overexpression of PRUNE in human sarcomas and breast carcinomas-a possible mechanism for altering the nm23-H1 activity." Forus A., D'Angelo A., Henriksen J., Merla G., Maelandsmo G.M., Floerenes V.A., Olivieri S., Bjerkehagen B., Meza-Zepeda L.A., del Vecchio Blanco F., Mueller C., Sanvito F., Kononen J., Nesland J.M., Fodstad O., Reymond A., Kallioniemi O.-P., Arrigoni G. Zollo M.Oncogene 20:6881-6890(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION. |
| [10] | "Prune cAMP phosphodiesterase binds nm23-H1 and promotes cancer metastasis." D'Angelo A., Garzia L., Andre A., Carotenuto P., Aglio V., Guardiola O., Arrigoni G., Cossu A., Palmieri G., Aravind L., Zollo M. Cancer Cell 5:137-149(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, INTERACTION WITH NME1, ENZYME REGULATION, MUTAGENESIS OF ASP-28; ASP-106; 126-ASP--PRO-129 AND ASP-179. |
| [11] | "Overexpression of h-prune in breast cancer is correlated with advanced disease status." Zollo M., Andre A., Cossu A., Sini M.C., D'Angelo A., Marino N., Budroni M., Tanda F., Arrigoni G., Palmieri G. Clin. Cancer Res. 11:199-205(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [12] | "Glycogen synthase kinase 3 and h-prune regulate cell migration by modulating focal adhesions." Kobayashi T., Hino S., Oue N., Asahara T., Zollo M., Yasui W., Kikuchi A. Mol. Cell. Biol. 26:898-911(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GSK3B, SUBCELLULAR LOCATION, FUNCTION. |
| [13] | "Domain mapping on the human metastasis regulator protein h-Prune reveals a C-terminal dimerization domain." Middelhaufe S., Garzia L., Ohndorf U.M., Kachholz B., Zollo M., Steegborn C. Biochem. J. 407:199-205(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NME1, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT. |
| [14] | "Phosphorylation of nm23-H1 by CKI induces its complex formation with h-prune and promotes cell motility." Garzia L., D'Angelo A., Amoresano A., Knauer S.K., Cirulli C., Campanella C., Stauber R.H., Steegborn C., Iolascon A., Zollo M. Oncogene 27:1853-1864(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NME1, FUNCTION. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF051907 mRNA. Translation: AAC95290.1. AF123538 mRNA. Translation: AAK00592.1. AF123539 mRNA. Translation: AAK00593.1. AK027875 mRNA. Translation: BAB55423.1. Different initiation. AK294154 mRNA. Translation: BAG57478.1. AK298273 mRNA. Translation: BAG60534.1. Different initiation. AK315120 mRNA. Translation: BAG37575.1. AL590133 Genomic DNA. Translation: CAI13338.1. AL590133 Genomic DNA. Translation: CAI13341.1. AL590133 Genomic DNA. Translation: CAI13342.1. AL590133 Genomic DNA. Translation: CAI13343.1. CH471121 Genomic DNA. Translation: EAW53486.1. CH471121 Genomic DNA. Translation: EAW53488.1. CH471121 Genomic DNA. Translation: EAW53489.1. BC014886 mRNA. Translation: AAH14886.1. BC025304 mRNA. Translation: AAH25304.1. BC063481 mRNA. Translation: AAH63481.1. U67085 mRNA. Translation: AAF04914.1. AL122054 mRNA. Translation: CAH56396.1. |
| IPI | IPI00028177. IPI00155261. IPI00166931. IPI00645747. IPI00895809. IPI00895854. IPI00929544. |
| RefSeq | NP_067045.1. NM_021222.1. |
| UniGene | Hs.78524. |
3D structure databases | |
| ProteinModelPortal | Q86TP1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86TP1. 2 interactions. |
PTM databases | |
| PhosphoSite | Q86TP1. |
Polymorphism databases | |
| DMDM | 229462737. |
Proteomic databases | |
| PaxDb | Q86TP1. |
| PRIDE | Q86TP1. |
Protocols and materials databases | |
| DNASU | 58497. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000271620; ENSP00000271620; ENSG00000143363. ENST00000368934; ENSP00000357930; ENSG00000143363. ENST00000368935; ENSP00000357931; ENSG00000143363. ENST00000368936; ENSP00000357932; ENSG00000143363. ENST00000368937; ENSP00000357933; ENSG00000143363. |
| GeneID | 58497. |
| KEGG | hsa:58497. |
| UCSC | uc001ewh.1. human. uc001ewj.1. human. uc001ewk.1. human. uc010pco.1. human. |
Organism-specific databases | |
| CTD | 58497. |
| GeneCards | GC01P150980. |
| H-InvDB | HIX0001042. |
| HGNC | HGNC:13420. PRUNE. |
| HPA | HPA028411. |
| neXtProt | NX_Q86TP1. |
| PharmGKB | PA134939749. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1227. |
| HOVERGEN | HBG058142. |
| InParanoid | Q86TP1. |
| KO | K01514. |
| OMA | IYMDLEA. |
| OrthoDB | EOG46Q6SG. |
| PhylomeDB | Q86TP1. |
Gene expression databases | |
| ArrayExpress | Q86TP1. |
| Bgee | Q86TP1. |
| CleanEx | HS_PRUNE. |
| Genevestigator | Q86TP1. |
Family and domain databases | |
| InterPro | IPR004097. DHHA2. IPR001667. Pesterase_RecJ. [Graphical view] |
| Pfam | PF01368. DHH. 1 hit. PF02833. DHHA2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 58497. |
| NextBio | 64992. |
Entry information
| Entry name | PRUNE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86TP1 Secondary accession number(s): B2RCH8 Q9UIV0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
