Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q86TN4

- TRPT1_HUMAN

UniProt

Q86TN4 - TRPT1_HUMAN

Protein

tRNA 2'-phosphotransferase 1

Gene

TRPT1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 2 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.1 Publication

    Catalytic activityi

    2'-phospho-[ligated tRNA] + NAD+ = mature tRNA + ADP ribose 1'',2''-phosphate + nicotinamide + H2O.

    GO - Molecular functioni

    1. tRNA 2'-phosphotransferase activity Source: UniProtKB-EC

    GO - Biological processi

    1. regulation of protein kinase activity Source: Ensembl
    2. tRNA splicing, via endonucleolytic cleavage and ligation Source: Ensembl

    Keywords - Molecular functioni

    Transferase

    Keywords - Biological processi

    tRNA processing

    Keywords - Ligandi

    NAD

    Enzyme and pathway databases

    BRENDAi2.7.1.160. 2681.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    tRNA 2'-phosphotransferase 1 (EC:2.7.1.160)
    Gene namesi
    Name:TRPT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:20316. TRPT1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134964265.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 253253tRNA 2'-phosphotransferase 1PRO_0000273363Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei240 – 2401Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ86TN4.
    PaxDbiQ86TN4.
    PRIDEiQ86TN4.

    PTM databases

    PhosphoSiteiQ86TN4.

    Expressioni

    Tissue specificityi

    Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes.1 Publication

    Gene expression databases

    ArrayExpressiQ86TN4.
    BgeeiQ86TN4.
    CleanExiHS_TRPT1.
    GenevestigatoriQ86TN4.

    Organism-specific databases

    HPAiHPA038705.
    HPA038706.

    Interactioni

    Protein-protein interaction databases

    BioGridi123736. 4 interactions.
    IntActiQ86TN4. 1 interaction.
    MINTiMINT-1485014.
    STRINGi9606.ENSP00000314073.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86TN4.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the KptA/TPT1 family.Curated

    Phylogenomic databases

    eggNOGiCOG1859.
    HOGENOMiHOG000229875.
    HOVERGENiHBG092612.
    InParanoidiQ86TN4.
    KOiK10669.
    OMAiLVHGTFW.
    OrthoDBiEOG738064.
    PhylomeDBiQ86TN4.
    TreeFamiTF324127.

    Family and domain databases

    InterProiIPR002745. Ptrans_KptA/Tpt1.
    [Graphical view]
    PfamiPF01885. PTS_2-RNA. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q86TN4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNFSGGGRQE AAGSRGRRAP RPREQDRDVQ LSKALSYALR HGALKLGLPM    50
    GADGFVPLGT LLQLPQFRGF SAEDVQRVVD TNRKQRFALQ LGDPSTGLLI 100
    RANQGHSLQV PKLELMPLET PQALPPMLVH GTFWKHWPSI LLKGLSCQGR 150
    THIHLAPGLP GDPGIISGMR SHCEIAVFID GPLALADGIP FFRSANGVIL 200
    TPGNTDGFLL PKYFKEALQL RPTRKPLSLA GDEETECQSS PKHSSRERRR 250
    IQQ 253
    Length:253
    Mass (Da):27,742
    Last modified:January 23, 2007 - v2
    Checksum:i6209F45DC3DB5CBF
    GO
    Isoform 2 (identifier: Q86TN4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:204
    Mass (Da):22,427
    Checksum:i5B7E72C0D6F702E4
    GO
    Isoform 3 (identifier: Q86TN4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         187-224: DGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTR → G

    Note: No experimental confirmation available.

    Show »
    Length:216
    Mass (Da):23,566
    Checksum:i5DA5CBDEAD3EC3EC
    GO
    Isoform 4 (identifier: Q86TN4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         109-109: Q → QVG

    Note: No experimental confirmation available.

    Show »
    Length:255
    Mass (Da):27,898
    Checksum:i6759213814CCB3BF
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti3 – 31F → L.
    Corresponds to variant rs12788168 [ dbSNP | Ensembl ].
    VAR_030134
    Natural varianti172 – 1721H → R.2 Publications
    Corresponds to variant rs1059440 [ dbSNP | Ensembl ].
    VAR_030135
    Natural varianti221 – 2211R → C.
    Corresponds to variant rs11549690 [ dbSNP | Ensembl ].
    VAR_030136

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4949Missing in isoform 2. 1 PublicationVSP_022524Add
    BLAST
    Alternative sequencei109 – 1091Q → QVG in isoform 4. CuratedVSP_045827
    Alternative sequencei187 – 22438DGIPF…LRPTR → G in isoform 3. 1 PublicationVSP_045273Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY211494 mRNA. Translation: AAO62941.1.
    AP005668 Genomic DNA. No translation available.
    AP006334 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74202.1.
    BC005133 mRNA. Translation: AAH05133.1.
    BQ672032 mRNA. No translation available.
    CCDSiCCDS31595.1. [Q86TN4-1]
    CCDS44639.1. [Q86TN4-2]
    CCDS53652.1. [Q86TN4-4]
    CCDS53653.1. [Q86TN4-3]
    RefSeqiNP_001028850.2. NM_001033678.3. [Q86TN4-1]
    NP_001153861.1. NM_001160389.1. [Q86TN4-4]
    NP_001153862.1. NM_001160390.1. [Q86TN4-1]
    NP_001153864.1. NM_001160392.1. [Q86TN4-3]
    NP_001153865.1. NM_001160393.1.
    NP_113660.1. NM_031472.3. [Q86TN4-2]
    UniGeneiHs.326586.

    Genome annotation databases

    EnsembliENST00000317459; ENSP00000314073; ENSG00000149743. [Q86TN4-1]
    ENST00000394546; ENSP00000378050; ENSG00000149743. [Q86TN4-4]
    ENST00000394547; ENSP00000378051; ENSG00000149743. [Q86TN4-2]
    ENST00000541278; ENSP00000438683; ENSG00000149743. [Q86TN4-3]
    GeneIDi83707.
    KEGGihsa:83707.
    UCSCiuc001nyn.3. human. [Q86TN4-1]

    Polymorphism databases

    DMDMi124053420.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY211494 mRNA. Translation: AAO62941.1 .
    AP005668 Genomic DNA. No translation available.
    AP006334 Genomic DNA. No translation available.
    CH471076 Genomic DNA. Translation: EAW74202.1 .
    BC005133 mRNA. Translation: AAH05133.1 .
    BQ672032 mRNA. No translation available.
    CCDSi CCDS31595.1. [Q86TN4-1 ]
    CCDS44639.1. [Q86TN4-2 ]
    CCDS53652.1. [Q86TN4-4 ]
    CCDS53653.1. [Q86TN4-3 ]
    RefSeqi NP_001028850.2. NM_001033678.3. [Q86TN4-1 ]
    NP_001153861.1. NM_001160389.1. [Q86TN4-4 ]
    NP_001153862.1. NM_001160390.1. [Q86TN4-1 ]
    NP_001153864.1. NM_001160392.1. [Q86TN4-3 ]
    NP_001153865.1. NM_001160393.1.
    NP_113660.1. NM_031472.3. [Q86TN4-2 ]
    UniGenei Hs.326586.

    3D structure databases

    ProteinModelPortali Q86TN4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123736. 4 interactions.
    IntActi Q86TN4. 1 interaction.
    MINTi MINT-1485014.
    STRINGi 9606.ENSP00000314073.

    PTM databases

    PhosphoSitei Q86TN4.

    Polymorphism databases

    DMDMi 124053420.

    Proteomic databases

    MaxQBi Q86TN4.
    PaxDbi Q86TN4.
    PRIDEi Q86TN4.

    Protocols and materials databases

    DNASUi 83707.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317459 ; ENSP00000314073 ; ENSG00000149743 . [Q86TN4-1 ]
    ENST00000394546 ; ENSP00000378050 ; ENSG00000149743 . [Q86TN4-4 ]
    ENST00000394547 ; ENSP00000378051 ; ENSG00000149743 . [Q86TN4-2 ]
    ENST00000541278 ; ENSP00000438683 ; ENSG00000149743 . [Q86TN4-3 ]
    GeneIDi 83707.
    KEGGi hsa:83707.
    UCSCi uc001nyn.3. human. [Q86TN4-1 ]

    Organism-specific databases

    CTDi 83707.
    GeneCardsi GC11M063991.
    HGNCi HGNC:20316. TRPT1.
    HPAi HPA038705.
    HPA038706.
    MIMi 610470. gene.
    neXtProti NX_Q86TN4.
    PharmGKBi PA134964265.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1859.
    HOGENOMi HOG000229875.
    HOVERGENi HBG092612.
    InParanoidi Q86TN4.
    KOi K10669.
    OMAi LVHGTFW.
    OrthoDBi EOG738064.
    PhylomeDBi Q86TN4.
    TreeFami TF324127.

    Enzyme and pathway databases

    BRENDAi 2.7.1.160. 2681.

    Miscellaneous databases

    GeneWikii TRPT1.
    GenomeRNAii 83707.
    NextBioi 72697.
    PROi Q86TN4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q86TN4.
    Bgeei Q86TN4.
    CleanExi HS_TRPT1.
    Genevestigatori Q86TN4.

    Family and domain databases

    InterProi IPR002745. Ptrans_KptA/Tpt1.
    [Graphical view ]
    Pfami PF01885. PTS_2-RNA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A human homolog of the yeast gene encoding tRNA 2'-phosphotransferase: cloning, characterization and complementation analysis."
      Hu Q.-D., Lu H., Huo K., Ying K., Li J., Xie Y., Mao Y., Li Y.-Y.
      Cell. Mol. Life Sci. 60:1725-1732(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-172.
      Tissue: Fetal brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-172.
      Tissue: Epidermal carcinoma and Ovary.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-240, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiTRPT1_HUMAN
    AccessioniPrimary (citable) accession number: Q86TN4
    Secondary accession number(s): A8MU17
    , A8MYC9, F5H2B2, Q9BSB9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2007
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 85 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3