Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q86TN4 (TRPT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
tRNA 2'-phosphotransferase 1

EC=2.7.1.160
Gene names
Name:TRPT1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length253 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate Probable. Ref.1

Catalytic activity

2'-phospho-[ligated tRNA] + NAD+ = mature tRNA + ADP ribose 1'',2''-phosphate + nicotinamide + H2O.

Tissue specificity

Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes. Ref.1

Sequence similarities

Belongs to the KptA/TPT1 family.

Ontologies

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q86TN4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q86TN4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q86TN4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     187-224: DGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTR → G
Note: No experimental confirmation available.
Isoform 4 (identifier: Q86TN4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: Q → QVG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 253253tRNA 2'-phosphotransferase 1
PRO_0000273363

Amino acid modifications

Modified residue11N-acetylmethionine Ref.8
Modified residue2401Phosphoserine Ref.7

Natural variations

Alternative sequence1 – 4949Missing in isoform 2.
VSP_022524
Alternative sequence1091Q → QVG in isoform 4.
VSP_045827
Alternative sequence187 – 22438DGIPF…LRPTR → G in isoform 3.
VSP_045273
Natural variant31F → L.
Corresponds to variant rs12788168 [ dbSNP | Ensembl ].
VAR_030134
Natural variant1721H → R. Ref.1 Ref.4
Corresponds to variant rs1059440 [ dbSNP | Ensembl ].
VAR_030135
Natural variant2211R → C.
Corresponds to variant rs11549690 [ dbSNP | Ensembl ].
VAR_030136

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2007. Version 2.
Checksum: 6209F45DC3DB5CBF

FASTA25327,742
        10         20         30         40         50         60 
MNFSGGGRQE AAGSRGRRAP RPREQDRDVQ LSKALSYALR HGALKLGLPM GADGFVPLGT 

        70         80         90        100        110        120 
LLQLPQFRGF SAEDVQRVVD TNRKQRFALQ LGDPSTGLLI RANQGHSLQV PKLELMPLET 

       130        140        150        160        170        180 
PQALPPMLVH GTFWKHWPSI LLKGLSCQGR THIHLAPGLP GDPGIISGMR SHCEIAVFID 

       190        200        210        220        230        240 
GPLALADGIP FFRSANGVIL TPGNTDGFLL PKYFKEALQL RPTRKPLSLA GDEETECQSS 

       250 
PKHSSRERRR IQQ 

« Hide

Isoform 2 [UniParc].

Checksum: 5B7E72C0D6F702E4
Show »

FASTA20422,427
Isoform 3 [UniParc].

Checksum: 5DA5CBDEAD3EC3EC
Show »

FASTA21623,566
Isoform 4 [UniParc].

Checksum: 6759213814CCB3BF
Show »

FASTA25527,898

References

« Hide 'large scale' references
[1]"A human homolog of the yeast gene encoding tRNA 2'-phosphotransferase: cloning, characterization and complementation analysis."
Hu Q.-D., Lu H., Huo K., Ying K., Li J., Xie Y., Mao Y., Li Y.-Y.
Cell. Mol. Life Sci. 60:1725-1732(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-172.
Tissue: Fetal brain.
[2]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-172.
Tissue: Epidermal carcinoma and Ovary.
[5]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-240, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY211494 mRNA. Translation: AAO62941.1.
AP005668 Genomic DNA. No translation available.
AP006334 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74202.1.
BC005133 mRNA. Translation: AAH05133.1.
BQ672032 mRNA. No translation available.
RefSeqNP_001028850.2. NM_001033678.3.
NP_001153861.1. NM_001160389.1.
NP_001153862.1. NM_001160390.1.
NP_001153864.1. NM_001160392.1.
NP_001153865.1. NM_001160393.1.
NP_113660.1. NM_031472.3.
UniGeneHs.326586.

3D structure databases

ProteinModelPortalQ86TN4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123736. 4 interactions.
IntActQ86TN4. 1 interaction.
MINTMINT-1485014.
STRING9606.ENSP00000314073.

PTM databases

PhosphoSiteQ86TN4.

Polymorphism databases

DMDM124053420.

Proteomic databases

PaxDbQ86TN4.
PRIDEQ86TN4.

Protocols and materials databases

DNASU83707.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317459; ENSP00000314073; ENSG00000149743. [Q86TN4-1]
ENST00000394546; ENSP00000378050; ENSG00000149743. [Q86TN4-4]
ENST00000394547; ENSP00000378051; ENSG00000149743. [Q86TN4-2]
ENST00000541278; ENSP00000438683; ENSG00000149743. [Q86TN4-3]
GeneID83707.
KEGGhsa:83707.
UCSCuc001nyn.3. human. [Q86TN4-1]

Organism-specific databases

CTD83707.
GeneCardsGC11M063991.
HGNCHGNC:20316. TRPT1.
HPAHPA038705.
HPA038706.
MIM610470. gene.
neXtProtNX_Q86TN4.
PharmGKBPA134964265.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1859.
HOGENOMHOG000229875.
HOVERGENHBG092612.
InParanoidQ86TN4.
KOK10669.
OMALVHGTFW.
OrthoDBEOG738064.
PhylomeDBQ86TN4.
TreeFamTF324127.

Enzyme and pathway databases

BRENDA2.7.1.160. 2681.

Gene expression databases

ArrayExpressQ86TN4.
BgeeQ86TN4.
CleanExHS_TRPT1.
GenevestigatorQ86TN4.

Family and domain databases

InterProIPR002745. Ptrans_KptA/Tpt1.
[Graphical view]
PfamPF01885. PTS_2-RNA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTRPT1.
GenomeRNAi83707.
NextBio72697.
PROQ86TN4.
SOURCESearch...

Entry information

Entry nameTRPT1_HUMAN
AccessionPrimary (citable) accession number: Q86TN4
Secondary accession number(s): A8MU17 expand/collapse secondary AC list , A8MYC9, F5H2B2, Q9BSB9
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM