SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q86TN4

- TRPT1_HUMAN

UniProt

Q86TN4 - TRPT1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

tRNA 2'-phosphotransferase 1

Gene
TRPT1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate Inferred.1 Publication

Catalytic activityi

2'-phospho-[ligated tRNA] + NAD+ = mature tRNA + ADP ribose 1'',2''-phosphate + nicotinamide + H2O.

GO - Molecular functioni

  1. tRNA 2'-phosphotransferase activity Source: UniProtKB-EC

GO - Biological processi

  1. regulation of protein kinase activity Source: Ensembl
  2. tRNA splicing, via endonucleolytic cleavage and ligation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

tRNA processing

Keywords - Ligandi

NAD

Enzyme and pathway databases

BRENDAi2.7.1.160. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA 2'-phosphotransferase 1 (EC:2.7.1.160)
Gene namesi
Name:TRPT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:20316. TRPT1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134964265.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 253253tRNA 2'-phosphotransferase 1PRO_0000273363Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei240 – 2401Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ86TN4.
PaxDbiQ86TN4.
PRIDEiQ86TN4.

PTM databases

PhosphoSiteiQ86TN4.

Expressioni

Tissue specificityi

Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes.1 Publication

Gene expression databases

ArrayExpressiQ86TN4.
BgeeiQ86TN4.
CleanExiHS_TRPT1.
GenevestigatoriQ86TN4.

Organism-specific databases

HPAiHPA038705.
HPA038706.

Interactioni

Protein-protein interaction databases

BioGridi123736. 4 interactions.
IntActiQ86TN4. 1 interaction.
MINTiMINT-1485014.
STRINGi9606.ENSP00000314073.

Structurei

3D structure databases

ProteinModelPortaliQ86TN4.

Family & Domainsi

Sequence similaritiesi

Belongs to the KptA/TPT1 family.

Phylogenomic databases

eggNOGiCOG1859.
HOGENOMiHOG000229875.
HOVERGENiHBG092612.
InParanoidiQ86TN4.
KOiK10669.
OMAiLVHGTFW.
OrthoDBiEOG738064.
PhylomeDBiQ86TN4.
TreeFamiTF324127.

Family and domain databases

InterProiIPR002745. Ptrans_KptA/Tpt1.
[Graphical view]
PfamiPF01885. PTS_2-RNA. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q86TN4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNFSGGGRQE AAGSRGRRAP RPREQDRDVQ LSKALSYALR HGALKLGLPM    50
GADGFVPLGT LLQLPQFRGF SAEDVQRVVD TNRKQRFALQ LGDPSTGLLI 100
RANQGHSLQV PKLELMPLET PQALPPMLVH GTFWKHWPSI LLKGLSCQGR 150
THIHLAPGLP GDPGIISGMR SHCEIAVFID GPLALADGIP FFRSANGVIL 200
TPGNTDGFLL PKYFKEALQL RPTRKPLSLA GDEETECQSS PKHSSRERRR 250
IQQ 253
Length:253
Mass (Da):27,742
Last modified:January 23, 2007 - v2
Checksum:i6209F45DC3DB5CBF
GO
Isoform 2 (identifier: Q86TN4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: Missing.

Note: No experimental confirmation available.

Show »
Length:204
Mass (Da):22,427
Checksum:i5B7E72C0D6F702E4
GO
Isoform 3 (identifier: Q86TN4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-224: DGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTR → G

Note: No experimental confirmation available.

Show »
Length:216
Mass (Da):23,566
Checksum:i5DA5CBDEAD3EC3EC
GO
Isoform 4 (identifier: Q86TN4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: Q → QVG

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):27,898
Checksum:i6759213814CCB3BF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti3 – 31F → L.
Corresponds to variant rs12788168 [ dbSNP | Ensembl ].
VAR_030134
Natural varianti172 – 1721H → R.2 Publications
Corresponds to variant rs1059440 [ dbSNP | Ensembl ].
VAR_030135
Natural varianti221 – 2211R → C.
Corresponds to variant rs11549690 [ dbSNP | Ensembl ].
VAR_030136

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4949Missing in isoform 2. VSP_022524Add
BLAST
Alternative sequencei109 – 1091Q → QVG in isoform 4. VSP_045827
Alternative sequencei187 – 22438DGIPF…LRPTR → G in isoform 3. VSP_045273Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY211494 mRNA. Translation: AAO62941.1.
AP005668 Genomic DNA. No translation available.
AP006334 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74202.1.
BC005133 mRNA. Translation: AAH05133.1.
BQ672032 mRNA. No translation available.
CCDSiCCDS31595.1. [Q86TN4-1]
CCDS44639.1. [Q86TN4-2]
CCDS53652.1. [Q86TN4-4]
CCDS53653.1. [Q86TN4-3]
RefSeqiNP_001028850.2. NM_001033678.3. [Q86TN4-1]
NP_001153861.1. NM_001160389.1. [Q86TN4-4]
NP_001153862.1. NM_001160390.1. [Q86TN4-1]
NP_001153864.1. NM_001160392.1. [Q86TN4-3]
NP_001153865.1. NM_001160393.1.
NP_113660.1. NM_031472.3. [Q86TN4-2]
UniGeneiHs.326586.

Genome annotation databases

EnsembliENST00000317459; ENSP00000314073; ENSG00000149743. [Q86TN4-1]
ENST00000394546; ENSP00000378050; ENSG00000149743. [Q86TN4-4]
ENST00000394547; ENSP00000378051; ENSG00000149743. [Q86TN4-2]
ENST00000541278; ENSP00000438683; ENSG00000149743. [Q86TN4-3]
GeneIDi83707.
KEGGihsa:83707.
UCSCiuc001nyn.3. human. [Q86TN4-1]

Polymorphism databases

DMDMi124053420.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY211494 mRNA. Translation: AAO62941.1 .
AP005668 Genomic DNA. No translation available.
AP006334 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74202.1 .
BC005133 mRNA. Translation: AAH05133.1 .
BQ672032 mRNA. No translation available.
CCDSi CCDS31595.1. [Q86TN4-1 ]
CCDS44639.1. [Q86TN4-2 ]
CCDS53652.1. [Q86TN4-4 ]
CCDS53653.1. [Q86TN4-3 ]
RefSeqi NP_001028850.2. NM_001033678.3. [Q86TN4-1 ]
NP_001153861.1. NM_001160389.1. [Q86TN4-4 ]
NP_001153862.1. NM_001160390.1. [Q86TN4-1 ]
NP_001153864.1. NM_001160392.1. [Q86TN4-3 ]
NP_001153865.1. NM_001160393.1.
NP_113660.1. NM_031472.3. [Q86TN4-2 ]
UniGenei Hs.326586.

3D structure databases

ProteinModelPortali Q86TN4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123736. 4 interactions.
IntActi Q86TN4. 1 interaction.
MINTi MINT-1485014.
STRINGi 9606.ENSP00000314073.

PTM databases

PhosphoSitei Q86TN4.

Polymorphism databases

DMDMi 124053420.

Proteomic databases

MaxQBi Q86TN4.
PaxDbi Q86TN4.
PRIDEi Q86TN4.

Protocols and materials databases

DNASUi 83707.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317459 ; ENSP00000314073 ; ENSG00000149743 . [Q86TN4-1 ]
ENST00000394546 ; ENSP00000378050 ; ENSG00000149743 . [Q86TN4-4 ]
ENST00000394547 ; ENSP00000378051 ; ENSG00000149743 . [Q86TN4-2 ]
ENST00000541278 ; ENSP00000438683 ; ENSG00000149743 . [Q86TN4-3 ]
GeneIDi 83707.
KEGGi hsa:83707.
UCSCi uc001nyn.3. human. [Q86TN4-1 ]

Organism-specific databases

CTDi 83707.
GeneCardsi GC11M063991.
HGNCi HGNC:20316. TRPT1.
HPAi HPA038705.
HPA038706.
MIMi 610470. gene.
neXtProti NX_Q86TN4.
PharmGKBi PA134964265.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1859.
HOGENOMi HOG000229875.
HOVERGENi HBG092612.
InParanoidi Q86TN4.
KOi K10669.
OMAi LVHGTFW.
OrthoDBi EOG738064.
PhylomeDBi Q86TN4.
TreeFami TF324127.

Enzyme and pathway databases

BRENDAi 2.7.1.160. 2681.

Miscellaneous databases

GeneWikii TRPT1.
GenomeRNAii 83707.
NextBioi 72697.
PROi Q86TN4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q86TN4.
Bgeei Q86TN4.
CleanExi HS_TRPT1.
Genevestigatori Q86TN4.

Family and domain databases

InterProi IPR002745. Ptrans_KptA/Tpt1.
[Graphical view ]
Pfami PF01885. PTS_2-RNA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A human homolog of the yeast gene encoding tRNA 2'-phosphotransferase: cloning, characterization and complementation analysis."
    Hu Q.-D., Lu H., Huo K., Ying K., Li J., Xie Y., Mao Y., Li Y.-Y.
    Cell. Mol. Life Sci. 60:1725-1732(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-172.
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-172.
    Tissue: Epidermal carcinoma and Ovary.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-240, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiTRPT1_HUMAN
AccessioniPrimary (citable) accession number: Q86TN4
Secondary accession number(s): A8MU17
, A8MYC9, F5H2B2, Q9BSB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: July 9, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi