Q86TN4 (TRPT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: tRNA 2'-phosphotransferase 1 EC=2.7.1.160 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 253 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate Probable. Ref.1 |
| Catalytic activity | 2'-phospho-[ligated tRNA] + NAD+ = mature tRNA + ADP ribose 1'',2''-phosphate + nicotinamide + H2O. |
| Tissue specificity | Widely expressed. Weakly or not expressed in lung, spleen, small intestine and peripheral blood leukocytes. Ref.1 |
| Sequence similarities | Belongs to the KptA/TPT1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | tRNA processing |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | NAD |
| Molecular function | Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | tRNA splicing, via endonucleolytic cleavage and ligation Inferred from electronic annotation. Source: InterPro |
| Molecular_function | tRNA 2'-phosphotransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86TN4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86TN4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-49: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q86TN4-3) The sequence of this isoform differs from the canonical sequence as follows: 187-224: DGIPFFRSANGVILTPGNTDGFLLPKYFKEALQLRPTR → G | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q86TN4-4) The sequence of this isoform differs from the canonical sequence as follows: 109-109: Q → QVG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 253 | 253 | tRNA 2'-phosphotransferase 1 | PRO_0000273363 | |||||
Amino acid modifications | |||||||||
| Modified residue | 240 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 49 | 49 | Missing in isoform 2. | VSP_022524 | |||||
| Alternative sequence | 109 | 1 | Q → QVG in isoform 4. | VSP_045827 | |||||
| Alternative sequence | 187 – 224 | 38 | DGIPF…LRPTR → G in isoform 3. | VSP_045273 | |||||
| Natural variant | 3 | 1 | F → L. Corresponds to variant rs12788168 [ dbSNP | Ensembl ]. | VAR_030134 | |||||
| Natural variant | 172 | 1 | H → R. Ref.1 Ref.4 Corresponds to variant rs1059440 [ dbSNP | Ensembl ]. | VAR_030135 | |||||
| Natural variant | 221 | 1 | R → C. Corresponds to variant rs11549690 [ dbSNP | Ensembl ]. | VAR_030136 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human homolog of the yeast gene encoding tRNA 2'-phosphotransferase: cloning, characterization and complementation analysis." Hu Q.-D., Lu H., Huo K., Ying K., Li J., Xie Y., Mao Y., Li Y.-Y. Cell. Mol. Life Sci. 60:1725-1732(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-172. Tissue: Fetal brain. |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-172. Tissue: Epidermal carcinoma and Ovary. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-240, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY211494 mRNA. Translation: AAO62941.1. AP005668 Genomic DNA. No translation available. AP006334 Genomic DNA. No translation available. CH471076 Genomic DNA. Translation: EAW74202.1. BC005133 mRNA. Translation: AAH05133.1. BQ672032 mRNA. No translation available. |
| IPI | IPI00328580. IPI00651758. IPI00930269. IPI00930313. |
| RefSeq | NP_001028850.2. NM_001033678.3. NP_001153861.1. NM_001160389.1. NP_001153862.1. NM_001160390.1. NP_001153864.1. NM_001160392.1. NP_001153865.1. NM_001160393.1. NP_113660.1. NM_031472.3. |
| UniGene | Hs.326586. |
3D structure databases | |
| ProteinModelPortal | Q86TN4. |
| SMR | Q86TN4. Positions 29-218. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86TN4. 1 interaction. |
| MINT | MINT-1485014. |
| STRING | 9606.ENSP00000314073. |
PTM databases | |
| PhosphoSite | Q86TN4. |
Polymorphism databases | |
| DMDM | 124053420. |
Proteomic databases | |
| PaxDb | Q86TN4. |
| PRIDE | Q86TN4. |
Protocols and materials databases | |
| DNASU | 83707. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317459; ENSP00000314073; ENSG00000149743. ENST00000394546; ENSP00000378050; ENSG00000149743. ENST00000394547; ENSP00000378051; ENSG00000149743. ENST00000541278; ENSP00000438683; ENSG00000149743. |
| GeneID | 83707. |
| KEGG | hsa:83707. |
| UCSC | uc001nyn.3. human. |
Organism-specific databases | |
| CTD | 83707. |
| GeneCards | GC11M063991. |
| HGNC | HGNC:20316. TRPT1. |
| HPA | HPA038706. |
| MIM | 610470. gene. |
| neXtProt | NX_Q86TN4. |
| PharmGKB | PA134964265. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1859. |
| HOGENOM | HOG000229875. |
| HOVERGEN | HBG092612. |
| InParanoid | Q86TN4. |
| KO | K10669. |
| OrthoDB | EOG44F6BB. |
| PhylomeDB | Q86TN4. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.160. 2681. |
Gene expression databases | |
| ArrayExpress | Q86TN4. |
| Bgee | Q86TN4. |
| CleanEx | HS_TRPT1. |
| Genevestigator | Q86TN4. |
Family and domain databases | |
| InterPro | IPR002745. Ptrans_KptA/Tpt1. [Graphical view] |
| Pfam | PF01885. PTS_2-RNA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83707. |
| NextBio | 72697. |
| SOURCE | Search... |
Entry information
| Entry name | TRPT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86TN4 Secondary accession number(s): A8MU17 Q9BSB9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
