Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dipeptidyl peptidase 9

Gene

DPP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2.

Catalytic activityi

Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, from a polypeptide, preferentially when Yaa is Pro, provided Zaa is neither Pro nor hydroxyproline.3 Publications

Enzyme regulationi

Inhibited by the serine proteinase inhibitor 4-(2-aminoethyl)benzenesulphonyl fluoride (AEBSF), and by di-isopropylfuorophosphate.1 Publication

Kineticsi

  1. KM=161 µM for Ala-Pro-AMC2 Publications
  2. KM=180 µM for Ala-Pro-AFC2 Publications

    pH dependencei

    Optimum pH is 7.5-8.5. Little activity below pH 6.5.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Active sitei730Charge relay systemBy similarity1
    Active sitei808Charge relay systemBy similarity1
    Active sitei840Charge relay systemBy similarity1

    GO - Molecular functioni

    Complete GO annotation...

    Keywords - Molecular functioni

    Aminopeptidase, Hydrolase, Protease, Serine protease

    Enzyme and pathway databases

    BioCyciZFISH:HS06888-MONOMER.
    SABIO-RKQ86TI2.

    Protein family/group databases

    ESTHERihuman-DPP9. DPP4N_Peptidase_S9.
    MEROPSiS09.019.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dipeptidyl peptidase 9 (EC:3.4.14.5)
    Short name:
    DP9
    Alternative name(s):
    Dipeptidyl peptidase IV-related protein 2
    Short name:
    DPRP-2
    Dipeptidyl peptidase IX
    Short name:
    DPP IX
    Dipeptidyl peptidase-like protein 9
    Short name:
    DPLP9
    Gene namesi
    Name:DPP9
    Synonyms:DPRP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:18648. DPP9.

    Subcellular locationi

    Isoform 1 :
    Isoform 2 :
    • Nucleus 1 Publication

    GO - Cellular componenti

    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi91039.
    MalaCardsiDPP9.
    OpenTargetsiENSG00000142002.
    Orphaneti2032. Idiopathic pulmonary fibrosis.
    PharmGKBiPA38620.

    Chemistry databases

    ChEMBLiCHEMBL4793.
    GuidetoPHARMACOLOGYi2357.

    Polymorphism and mutation databases

    DMDMi67460390.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Initiator methionineiRemovedCombined sources
    ChainiPRO_00001224152 – 863Dipeptidyl peptidase 9Add BLAST862

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei2N-acetylalanineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    EPDiQ86TI2.
    MaxQBiQ86TI2.
    PaxDbiQ86TI2.
    PeptideAtlasiQ86TI2.
    PRIDEiQ86TI2.

    PTM databases

    iPTMnetiQ86TI2.
    PhosphoSitePlusiQ86TI2.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain.3 Publications

    Gene expression databases

    BgeeiENSG00000142002.
    ExpressionAtlasiQ86TI2. baseline and differential.
    GenevisibleiQ86TI2. HS.

    Organism-specific databases

    HPAiHPA036059.

    Interactioni

    Subunit structurei

    Homodimer.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-7475352,EBI-7475352

    Protein-protein interaction databases

    BioGridi124789. 46 interactors.
    IntActiQ86TI2. 5 interactors.
    MINTiMINT-4535936.
    STRINGi9606.ENSP00000262960.

    Chemistry databases

    BindingDBiQ86TI2.

    Structurei

    3D structure databases

    ProteinModelPortaliQ86TI2.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase S9B family. DPPIV subfamily.Curated

    Phylogenomic databases

    eggNOGiKOG2281. Eukaryota.
    COG1506. LUCA.
    GeneTreeiENSGT00760000119233.
    HOGENOMiHOG000006870.
    HOVERGENiHBG061620.
    InParanoidiQ86TI2.
    KOiK08656.
    OMAiQPHVVYE.
    OrthoDBiEOG091G05F9.
    PhylomeDBiQ86TI2.
    TreeFamiTF313309.

    Family and domain databases

    Gene3Di2.140.10.30. 1 hit.
    3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR001375. Peptidase_S9.
    IPR002469. Peptidase_S9B_N.
    [Graphical view]
    PfamiPF00930. DPPIV_N. 1 hit.
    PF00326. Peptidase_S9. 1 hit.
    [Graphical view]
    SUPFAMiSSF53474. SSF53474. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q86TI2-1) [UniParc]FASTAAdd to basket
    Also known as: DPP9-S, Short

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MATTGTPTAD RGDAAATDDP AARFQVQKHS WDGLRSIIHG SRKYSGLIVN
    60 70 80 90 100
    KAPHDFQFVQ KTDESGPHSH RLYYLGMPYG SRENSLLYSE IPKKVRKEAL
    110 120 130 140 150
    LLLSWKQMLD HFQATPHHGV YSREEELLRE RKRLGVFGIT SYDFHSESGL
    160 170 180 190 200
    FLFQASNSLF HCRDGGKNGF MVSPMKPLEI KTQCSGPRMD PKICPADPAF
    210 220 230 240 250
    FSFINNSDLW VANIETGEER RLTFCHQGLS NVLDDPKSAG VATFVIQEEF
    260 270 280 290 300
    DRFTGYWWCP TASWEGSEGL KTLRILYEEV DESEVEVIHV PSPALEERKT
    310 320 330 340 350
    DSYRYPRTGS KNPKIALKLA EFQTDSQGKI VSTQEKELVQ PFSSLFPKVE
    360 370 380 390 400
    YIARAGWTRD GKYAWAMFLD RPQQWLQLVL LPPALFIPST ENEEQRLASA
    410 420 430 440 450
    RAVPRNVQPY VVYEEVTNVW INVHDIFYPF PQSEGEDELC FLRANECKTG
    460 470 480 490 500
    FCHLYKVTAV LKSQGYDWSE PFSPGEDEFK CPIKEEIALT SGEWEVLARH
    510 520 530 540 550
    GSKIWVNEET KLVYFQGTKD TPLEHHLYVV SYEAAGEIVR LTTPGFSHSC
    560 570 580 590 600
    SMSQNFDMFV SHYSSVSTPP CVHVYKLSGP DDDPLHKQPR FWASMMEAAS
    610 620 630 640 650
    CPPDYVPPEI FHFHTRSDVR LYGMIYKPHA LQPGKKHPTV LFVYGGPQVQ
    660 670 680 690 700
    LVNNSFKGIK YLRLNTLASL GYAVVVIDGR GSCQRGLRFE GALKNQMGQV
    710 720 730 740 750
    EIEDQVEGLQ FVAEKYGFID LSRVAIHGWS YGGFLSLMGL IHKPQVFKVA
    760 770 780 790 800
    IAGAPVTVWM AYDTGYTERY MDVPENNQHG YEAGSVALHV EKLPNEPNRL
    810 820 830 840 850
    LILHGFLDEN VHFFHTNFLV SQLIRAGKPY QLQIYPNERH SIRCPESGEH
    860
    YEVTLLHFLQ EYL
    Length:863
    Mass (Da):98,263
    Last modified:June 7, 2005 - v3
    Checksum:i40FE0B78E26CDED5
    GO
    Isoform 2 (identifier: Q86TI2-2) [UniParc]FASTAAdd to basket
    Also known as: DPP9-L, Long

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRKVKKLRLDKENTGSWRSFSLNSEGAERM

    Note: Active peptidase. Contains a nuclear localization signal at positions 2-9.1 Publication
    Show »
    Length:892
    Mass (Da):101,669
    Checksum:i2CDB8E40E428AE73
    GO
    Isoform 3 (identifier: Q86TI2-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         832-858: Missing.

    Show »
    Length:836
    Mass (Da):95,013
    Checksum:iEF3B224CF112B857
    GO

    Sequence cautioni

    The sequence AAC33801 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAC62840 differs from that shown. Reason: Erroneous gene model prediction.Curated
    The sequence AAH37948 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAL47179 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAO73880 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
    The sequence BAB70784 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC11362 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence BAC85150 differs from that shown. Probable cloning artifact.Curated
    The sequence BAD18643 differs from that shown. Aberrant splicing.Curated
    The sequence CAD39039 differs from that shown. Reason: Frameshift at positions 432 and 460.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti204I → N in AAO73880 (PubMed:15245913).Curated1
    Sequence conflicti204I → N in AAQ83119 (PubMed:15245913).Curated1
    Sequence conflicti461L → F in CAD39039 (PubMed:17974005).Curated1
    Sequence conflicti571C → W in BAC85150 (PubMed:14702039).Curated1
    Sequence conflicti709L → P in BAD18643 (PubMed:14702039).Curated1
    Sequence conflicti753G → C in BAB70784 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0138651M → MRKVKKLRLDKENTGSWRSF SLNSEGAERM in isoform 2. 4 Publications1
    Alternative sequenceiVSP_013869832 – 858Missing in isoform 3. 1 PublicationAdd BLAST27

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF452102 mRNA. Translation: AAL47179.1. Different initiation.
    AY172660 mRNA. Translation: AAO17262.1.
    AF542510 mRNA. Translation: AAO73880.2. Different initiation.
    AY374518 mRNA. Translation: AAQ83119.1.
    DQ417928 mRNA. Translation: ABD83624.1.
    AK054656 mRNA. Translation: BAB70784.1. Different initiation.
    AK075030 mRNA. Translation: BAC11362.1. Different initiation.
    AK122654 mRNA. Translation: BAG53644.1.
    AK131100 mRNA. Translation: BAC85150.1. Sequence problems.
    AK131499 mRNA. Translation: BAD18643.1. Sequence problems.
    AC005594 Genomic DNA. Translation: AAC33801.1. Sequence problems.
    AC005783 Genomic DNA. Translation: AAC62840.1. Sequence problems.
    CH471139 Genomic DNA. Translation: EAW69199.1.
    CH471139 Genomic DNA. Translation: EAW69201.1.
    BC000970 mRNA. Translation: AAH00970.1.
    BC037948 mRNA. Translation: AAH37948.1. Different initiation.
    AL834376 mRNA. Translation: CAD39039.3. Frameshift.
    CR627380 mRNA. Translation: CAH10477.1.
    CCDSiCCDS45928.1. [Q86TI2-2]
    RefSeqiNP_631898.3. NM_139159.4. [Q86TI2-2]
    XP_005259730.1. XM_005259673.2. [Q86TI2-2]
    XP_011526710.1. XM_011528408.1. [Q86TI2-2]
    XP_011526712.1. XM_011528410.1. [Q86TI2-1]
    UniGeneiHs.515081.

    Genome annotation databases

    EnsembliENST00000262960; ENSP00000262960; ENSG00000142002. [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002. [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002. [Q86TI2-1]
    GeneIDi91039.
    KEGGihsa:91039.
    UCSCiuc002mba.5. human. [Q86TI2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF452102 mRNA. Translation: AAL47179.1. Different initiation.
    AY172660 mRNA. Translation: AAO17262.1.
    AF542510 mRNA. Translation: AAO73880.2. Different initiation.
    AY374518 mRNA. Translation: AAQ83119.1.
    DQ417928 mRNA. Translation: ABD83624.1.
    AK054656 mRNA. Translation: BAB70784.1. Different initiation.
    AK075030 mRNA. Translation: BAC11362.1. Different initiation.
    AK122654 mRNA. Translation: BAG53644.1.
    AK131100 mRNA. Translation: BAC85150.1. Sequence problems.
    AK131499 mRNA. Translation: BAD18643.1. Sequence problems.
    AC005594 Genomic DNA. Translation: AAC33801.1. Sequence problems.
    AC005783 Genomic DNA. Translation: AAC62840.1. Sequence problems.
    CH471139 Genomic DNA. Translation: EAW69199.1.
    CH471139 Genomic DNA. Translation: EAW69201.1.
    BC000970 mRNA. Translation: AAH00970.1.
    BC037948 mRNA. Translation: AAH37948.1. Different initiation.
    AL834376 mRNA. Translation: CAD39039.3. Frameshift.
    CR627380 mRNA. Translation: CAH10477.1.
    CCDSiCCDS45928.1. [Q86TI2-2]
    RefSeqiNP_631898.3. NM_139159.4. [Q86TI2-2]
    XP_005259730.1. XM_005259673.2. [Q86TI2-2]
    XP_011526710.1. XM_011528408.1. [Q86TI2-2]
    XP_011526712.1. XM_011528410.1. [Q86TI2-1]
    UniGeneiHs.515081.

    3D structure databases

    ProteinModelPortaliQ86TI2.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi124789. 46 interactors.
    IntActiQ86TI2. 5 interactors.
    MINTiMINT-4535936.
    STRINGi9606.ENSP00000262960.

    Chemistry databases

    BindingDBiQ86TI2.
    ChEMBLiCHEMBL4793.
    GuidetoPHARMACOLOGYi2357.

    Protein family/group databases

    ESTHERihuman-DPP9. DPP4N_Peptidase_S9.
    MEROPSiS09.019.

    PTM databases

    iPTMnetiQ86TI2.
    PhosphoSitePlusiQ86TI2.

    Polymorphism and mutation databases

    DMDMi67460390.

    Proteomic databases

    EPDiQ86TI2.
    MaxQBiQ86TI2.
    PaxDbiQ86TI2.
    PeptideAtlasiQ86TI2.
    PRIDEiQ86TI2.

    Protocols and materials databases

    DNASUi91039.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000262960; ENSP00000262960; ENSG00000142002. [Q86TI2-2]
    ENST00000594671; ENSP00000472224; ENSG00000142002. [Q86TI2-4]
    ENST00000598800; ENSP00000469603; ENSG00000142002. [Q86TI2-1]
    GeneIDi91039.
    KEGGihsa:91039.
    UCSCiuc002mba.5. human. [Q86TI2-1]

    Organism-specific databases

    CTDi91039.
    DisGeNETi91039.
    GeneCardsiDPP9.
    H-InvDBHIX0027578.
    HGNCiHGNC:18648. DPP9.
    HPAiHPA036059.
    MalaCardsiDPP9.
    MIMi608258. gene.
    neXtProtiNX_Q86TI2.
    OpenTargetsiENSG00000142002.
    Orphaneti2032. Idiopathic pulmonary fibrosis.
    PharmGKBiPA38620.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG2281. Eukaryota.
    COG1506. LUCA.
    GeneTreeiENSGT00760000119233.
    HOGENOMiHOG000006870.
    HOVERGENiHBG061620.
    InParanoidiQ86TI2.
    KOiK08656.
    OMAiQPHVVYE.
    OrthoDBiEOG091G05F9.
    PhylomeDBiQ86TI2.
    TreeFamiTF313309.

    Enzyme and pathway databases

    BioCyciZFISH:HS06888-MONOMER.
    SABIO-RKQ86TI2.

    Miscellaneous databases

    ChiTaRSiDPP9. human.
    GeneWikiiDPP9.
    GenomeRNAii91039.
    PROiQ86TI2.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000142002.
    ExpressionAtlasiQ86TI2. baseline and differential.
    GenevisibleiQ86TI2. HS.

    Family and domain databases

    Gene3Di2.140.10.30. 1 hit.
    3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR001375. Peptidase_S9.
    IPR002469. Peptidase_S9B_N.
    [Graphical view]
    PfamiPF00930. DPPIV_N. 1 hit.
    PF00326. Peptidase_S9. 1 hit.
    [Graphical view]
    SUPFAMiSSF53474. SSF53474. 1 hit.
    ProtoNetiSearch...

    Entry informationi

    Entry nameiDPP9_HUMAN
    AccessioniPrimary (citable) accession number: Q86TI2
    Secondary accession number(s): O75273
    , O75868, Q1ZZB8, Q6AI37, Q6UAL0, Q6ZMT2, Q6ZNJ5, Q8N2J7, Q8N3F5, Q8WXD8, Q96NT8, Q9BVR3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: June 7, 2005
    Last modified: November 2, 2016
    This is version 131 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Peptidase families
      Classification of peptidase families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.