Q86TI2 (DPP9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dipeptidyl peptidase 9 Short name=DP9 EC=3.4.14.5 Alternative name(s): Dipeptidyl peptidase IV-related protein 2 Short name=DPRP-2 Dipeptidyl peptidase IX Short name=DPP IX Dipeptidyl peptidase-like protein 9 Short name=DPLP9 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 863 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. |
| Catalytic activity | Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, from a polypeptide, preferentially when Yaa is Pro, provided Zaa is neither Pro nor hydroxyproline. Ref.2 Ref.3 Ref.4 |
| Enzyme regulation | Inhibited by the serine proteinase inhibitor 4-(2-aminoethyl)benzenesulphonyl fluoride (AEBSF), and by di-isopropylfuorophosphate. Ref.2 |
| Subunit structure | Homodimer. Ref.4 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain. Ref.1 Ref.2 Ref.3 |
| Sequence similarities | Belongs to the peptidase S9B family. DPPIV subfamily. |
| Biophysicochemical properties | Kinetic parameters: KM=161 µM for Ala-Pro-AMC Ref.2 Ref.3 KM=180 µM for Ala-Pro-AFC pH dependence: Optimum pH is 7.5-8.5. Little activity below pH 6.5. |
| Sequence caution | The sequence AAC33801.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAC62840.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAH37948.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAL47179.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAO73880.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB70784.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAC11362.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAC85150.1 differs from that shown. Reason: Probable cloning artifact. The sequence BAD18643.1 differs from that shown. Reason: Aberrant splicing. The sequence CAD39039.3 differs from that shown. Reason: Frameshift at positions 432 and 460. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Aminopeptidase Hydrolase Protease Serine protease |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA cytosolInferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: InterPro |
| Molecular_function | aminopeptidase activity Inferred from electronic annotation. Source: UniProtKB-KW serine-type peptidase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86TI2-1) Also known as: Short; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86TI2-2) Also known as: Long; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRKVKKLRLDKENTGSWRSFSLNSEGAERM | ||||||
| Note: Incomplete sequence. | ||||||
| Isoform 3 (identifier: Q86TI2-4) The sequence of this isoform differs from the canonical sequence as follows: 832-858: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 863 | 863 | Dipeptidyl peptidase 9 | PRO_0000122415 | |||||
Sites | |||||||||
| Active site | 730 | 1 | Charge relay system By similarity | ||||||
| Active site | 808 | 1 | Charge relay system By similarity | ||||||
| Active site | 840 | 1 | Charge relay system By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRKVKKLRLDKENTGSWRSF SLNSEGAERM in isoform 2. | VSP_013865 | |||||
| Alternative sequence | 832 – 858 | 27 | Missing in isoform 3. | VSP_013869 | |||||
Experimental info | |||||||||
| Sequence conflict | 204 | 1 | I → N in AAO73880. Ref.3 | ||||||
| Sequence conflict | 204 | 1 | I → N in AAQ83119. Ref.3 | ||||||
| Sequence conflict | 461 | 1 | L → F in CAD39039. Ref.9 | ||||||
| Sequence conflict | 571 | 1 | C → W in BAC85150. Ref.5 | ||||||
| Sequence conflict | 709 | 1 | L → P in BAD18643. Ref.5 | ||||||
| Sequence conflict | 753 | 1 | G → C in BAB70784. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of human DPP9, a novel homologue of dipeptidyl peptidase IV." Olsen C., Wagtmann N. Gene 299:185-193(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. |
| [2] | "Cloning and characterization of dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases." Qi S.Y., Riviere P.J., Trojnar J., Junien J.-L., Akinsanya K.O. Biochem. J. 373:179-189(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. Tissue: Colon. |
| [3] | "Dipeptidyl peptidase 9 has two forms, a broad tissue distribution, cytoplasmic localization and DPIV-like peptidase activity." Ajami K., Abbott C.A., McCaughan G.W., Gorrell M.D. Biochim. Biophys. Acta 1679:18-28(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [4] | "Dipeptidyl peptidases 8 and 9: specificity and molecular characterization compared with dipeptidyl peptidase IV." Bjelke J.R., Christensen J., Nielsen P.F., Branner S., Kanstrup A.B., Wagtmann N., Rasmussen H.B. Biochem. J. 396:391-399(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CATALYTIC ACTIVITY, SUBUNIT. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 30-649 (ISOFORMS 1/3). Tissue: Glial tumor, Ovary, Spleen and Trachea. |
| [6] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta and Skin. |
| [9] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 209-863 (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 298-863 (ISOFORMS 1/2). Tissue: Melanoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF452102 mRNA. Translation: AAL47179.1. Different initiation. AY172660 mRNA. Translation: AAO17262.1. AF542510 mRNA. Translation: AAO73880.2. Different initiation. AY374518 mRNA. Translation: AAQ83119.1. DQ417928 mRNA. Translation: ABD83624.1. AK054656 mRNA. Translation: BAB70784.1. Different initiation. AK075030 mRNA. Translation: BAC11362.1. Different initiation. AK122654 mRNA. Translation: BAG53644.1. AK131100 mRNA. Translation: BAC85150.1. Sequence problems. AK131499 mRNA. Translation: BAD18643.1. Sequence problems. AC005594 Genomic DNA. Translation: AAC33801.1. Sequence problems. AC005783 Genomic DNA. Translation: AAC62840.1. Sequence problems. CH471139 Genomic DNA. Translation: EAW69199.1. CH471139 Genomic DNA. Translation: EAW69201.1. BC000970 mRNA. Translation: AAH00970.1. BC037948 mRNA. Translation: AAH37948.1. Different initiation. AL834376 mRNA. Translation: CAD39039.3. Frameshift. CR627380 mRNA. Translation: CAH10477.1. |
| IPI | IPI00604483. IPI00604645. IPI00604694. IPI00604777. IPI01008830. |
| RefSeq | NP_631898.3. NM_139159.4. |
| UniGene | Hs.515081. |
3D structure databases | |
| ProteinModelPortal | Q86TI2. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | S09.019. |
PTM databases | |
| PhosphoSite | Q86TI2. |
Polymorphism databases | |
| DMDM | 67460390. |
Proteomic databases | |
| PaxDb | Q86TI2. |
| PRIDE | Q86TI2. |
Protocols and materials databases | |
| DNASU | 91039. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262960; ENSP00000262960; ENSG00000142002. ENST00000594671; ENSP00000472224; ENSG00000142002. ENST00000598800; ENSP00000469603; ENSG00000142002. |
| GeneID | 91039. |
| KEGG | hsa:91039. |
Organism-specific databases | |
| CTD | 91039. |
| GeneCards | GC19M004626. |
| H-InvDB | HIX0027578. |
| HGNC | HGNC:18648. DPP9. |
| HPA | HPA036059. |
| MIM | 608258. gene. |
| neXtProt | NX_Q86TI2. |
| PharmGKB | PA38620. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1506. |
| HOVERGEN | HBG061620. |
| InParanoid | Q86TI2. |
| KO | K08656. |
| OrthoDB | EOG4BVRSX. |
Gene expression databases | |
| ArrayExpress | Q86TI2. |
| Bgee | Q86TI2. |
| Genevestigator | Q86TI2. |
| GermOnline | ENSG00000142002. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001375. Peptidase_S9. IPR002469. Peptidase_S9B. [Graphical view] |
| Pfam | PF00930. DPPIV_N. 1 hit. PF00326. Peptidase_S9. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q86TI2. |
| ChEMBL | CHEMBL4793. |
| ChiTaRS | DPP9. human. |
| GenomeRNAi | 91039. |
| NextBio | 77078. |
| SOURCE | Search... |
Entry information
| Entry name | DPP9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86TI2 Secondary accession number(s): O75273 Q9BVR3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
