Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 150A

Gene

TMEM150A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates localization of phosphatidylinositol 4-kinase (PI4K) to the plasma membrane, possibly by reducing the association of TTC7 (TTC7A or TTC7B) with the PI4K complex (PubMed:25608530). Acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns4P) synthesis (PubMed:25608530). May also play a role in fasting-induced catabolism (By similarity).By similarity1 Publication

GO - Biological processi

  • catabolic process Source: Ensembl
  • establishment of protein localization to plasma membrane Source: UniProtKB
  • phosphatidylinositol phosphorylation Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 150A
Alternative name(s):
Transmembrane protein 150
Gene namesi
Name:TMEM150A
Synonyms:TMEM150
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24677. TMEM150A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 2CytoplasmicCurated2
Transmembranei3 – 23HelicalSequence analysisAdd BLAST21
Topological domaini24 – 75ExtracellularCuratedAdd BLAST52
Transmembranei76 – 96HelicalSequence analysisAdd BLAST21
Topological domaini97 – 108CytoplasmicCuratedAdd BLAST12
Transmembranei109 – 129HelicalSequence analysisAdd BLAST21
Topological domaini130 – 140ExtracellularCuratedAdd BLAST11
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21
Topological domaini162 – 178CytoplasmicCuratedAdd BLAST17
Transmembranei179 – 199HelicalSequence analysisAdd BLAST21
Topological domaini200 – 211ExtracellularCuratedAdd BLAST12
Transmembranei212 – 232HelicalSequence analysisAdd BLAST21
Topological domaini233 – 271Cytoplasmic1 PublicationAdd BLAST39

GO - Cellular componenti

  • integral component of plasma membrane Source: UniProtKB
  • lysosome Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000168890.
PharmGKBiPA165697532.

Polymorphism and mutation databases

BioMutaiTMEM150A.
DMDMi74727425.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002747751 – 271Transmembrane protein 150AAdd BLAST271

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi37N-linked (GlcNAc...)Sequence analysis1
Glycosylationi41N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ86TG1.
PRIDEiQ86TG1.

PTM databases

iPTMnetiQ86TG1.
PhosphoSitePlusiQ86TG1.

Expressioni

Gene expression databases

BgeeiENSG00000168890.
CleanExiHS_TMEM150.
ExpressionAtlasiQ86TG1. baseline and differential.
GenevisibleiQ86TG1. HS.

Organism-specific databases

HPAiHPA019015.

Interactioni

Subunit structurei

Interacts (via C-terminal cytoplasmic tail) with PI4KA.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-2799342,EBI-10173507
KRTAP10-8P604103EBI-2799342,EBI-10171774
NOTCH2NLQ7Z3S95EBI-2799342,EBI-945833

Protein-protein interaction databases

BioGridi126189. 9 interactors.
IntActiQ86TG1. 4 interactors.
STRINGi9606.ENSP00000334708.

Structurei

3D structure databases

ProteinModelPortaliQ86TG1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DRAM/TMEM150 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4320. Eukaryota.
ENOG4111KNB. LUCA.
GeneTreeiENSGT00730000110794.
HOGENOMiHOG000251588.
InParanoidiQ86TG1.
OMAiCEWVFVI.
OrthoDBiEOG091G0CJL.
PhylomeDBiQ86TG1.
TreeFamiTF314508.

Family and domain databases

InterProiIPR019402. Frag1/DRAM/Sfk1.
IPR027315. TMEM150A.
[Graphical view]
PANTHERiPTHR21324:SF6. PTHR21324:SF6. 2 hits.
PfamiPF10277. Frag1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86TG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAWILLPVS LSAFSITGIW TVYAMAVMNH HVCPVENWSY NESCPPDPAE
60 70 80 90 100
QGGPKTCCTL DDVPLISKCG SYPPESCLFS LIGNMGAFMV ALICLLRYGQ
110 120 130 140 150
LLEQSRHSWV NTTALITGCT NAAGLLVVGN FQVDHARSLH YVGAGVAFPA
160 170 180 190 200
GLLFVCLHCA LSYQGATAPL DLAVAYLRSV LAVIAFITLV LSGVFFVHES
210 220 230 240 250
SQLQHGAALC EWVCVIDILI FYGTFSYEFG AVSSDTLVAA LQPTPGRACK
260 270
SSGSSSTSTH LNCAPESIAM I
Length:271
Mass (Da):28,835
Last modified:June 1, 2003 - v1
Checksum:i2995A8A8C53C35B0
GO
Isoform 2 (identifier: Q86TG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     61-89: DDVPLISKCGSYPPESCLFSLIGNMGAFM → MYALWRTGPTTSPALLTLLSKGVPRPAAPWTMSPSS

Show »
Length:218
Mass (Da):23,035
Checksum:iF43ED33C257B156F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti219L → P in BAC11029 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0228741 – 60Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_02287561 – 89DDVPL…MGAFM → MYALWRTGPTTSPALLTLLS KGVPRPAAPWTMSPSS in isoform 2. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074505 mRNA. Translation: BAC11029.1.
AK291879 mRNA. Translation: BAF84568.1.
AC016753 Genomic DNA. Translation: AAY24344.1.
CH471053 Genomic DNA. Translation: EAW99503.1.
CH471053 Genomic DNA. Translation: EAW99499.1.
CH471053 Genomic DNA. Translation: EAW99500.1.
BC050466 mRNA. Translation: AAH50466.1.
CCDSiCCDS33233.1. [Q86TG1-1]
RefSeqiNP_001026908.1. NM_001031738.2. [Q86TG1-1]
XP_006711993.1. XM_006711930.3. [Q86TG1-1]
XP_006711994.1. XM_006711931.3. [Q86TG1-1]
XP_006711995.1. XM_006711932.2. [Q86TG1-2]
XP_011530810.1. XM_011532508.2. [Q86TG1-2]
UniGeneiHs.591559.

Genome annotation databases

EnsembliENST00000306353; ENSP00000302715; ENSG00000168890. [Q86TG1-2]
ENST00000334462; ENSP00000334708; ENSG00000168890. [Q86TG1-1]
ENST00000409668; ENSP00000387292; ENSG00000168890. [Q86TG1-1]
GeneIDi129303.
KEGGihsa:129303.
UCSCiuc002spy.3. human. [Q86TG1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK074505 mRNA. Translation: BAC11029.1.
AK291879 mRNA. Translation: BAF84568.1.
AC016753 Genomic DNA. Translation: AAY24344.1.
CH471053 Genomic DNA. Translation: EAW99503.1.
CH471053 Genomic DNA. Translation: EAW99499.1.
CH471053 Genomic DNA. Translation: EAW99500.1.
BC050466 mRNA. Translation: AAH50466.1.
CCDSiCCDS33233.1. [Q86TG1-1]
RefSeqiNP_001026908.1. NM_001031738.2. [Q86TG1-1]
XP_006711993.1. XM_006711930.3. [Q86TG1-1]
XP_006711994.1. XM_006711931.3. [Q86TG1-1]
XP_006711995.1. XM_006711932.2. [Q86TG1-2]
XP_011530810.1. XM_011532508.2. [Q86TG1-2]
UniGeneiHs.591559.

3D structure databases

ProteinModelPortaliQ86TG1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126189. 9 interactors.
IntActiQ86TG1. 4 interactors.
STRINGi9606.ENSP00000334708.

PTM databases

iPTMnetiQ86TG1.
PhosphoSitePlusiQ86TG1.

Polymorphism and mutation databases

BioMutaiTMEM150A.
DMDMi74727425.

Proteomic databases

PaxDbiQ86TG1.
PRIDEiQ86TG1.

Protocols and materials databases

DNASUi129303.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306353; ENSP00000302715; ENSG00000168890. [Q86TG1-2]
ENST00000334462; ENSP00000334708; ENSG00000168890. [Q86TG1-1]
ENST00000409668; ENSP00000387292; ENSG00000168890. [Q86TG1-1]
GeneIDi129303.
KEGGihsa:129303.
UCSCiuc002spy.3. human. [Q86TG1-1]

Organism-specific databases

CTDi129303.
GeneCardsiTMEM150A.
HGNCiHGNC:24677. TMEM150A.
HPAiHPA019015.
MIMi616757. gene.
neXtProtiNX_Q86TG1.
OpenTargetsiENSG00000168890.
PharmGKBiPA165697532.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4320. Eukaryota.
ENOG4111KNB. LUCA.
GeneTreeiENSGT00730000110794.
HOGENOMiHOG000251588.
InParanoidiQ86TG1.
OMAiCEWVFVI.
OrthoDBiEOG091G0CJL.
PhylomeDBiQ86TG1.
TreeFamiTF314508.

Miscellaneous databases

ChiTaRSiTMEM150A. human.
GeneWikiiTMEM150.
GenomeRNAii129303.
PROiQ86TG1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168890.
CleanExiHS_TMEM150.
ExpressionAtlasiQ86TG1. baseline and differential.
GenevisibleiQ86TG1. HS.

Family and domain databases

InterProiIPR019402. Frag1/DRAM/Sfk1.
IPR027315. TMEM150A.
[Graphical view]
PANTHERiPTHR21324:SF6. PTHR21324:SF6. 2 hits.
PfamiPF10277. Frag1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiT150A_HUMAN
AccessioniPrimary (citable) accession number: Q86TG1
Secondary accession number(s): A8K764
, B7WPQ9, D6W5L2, Q8N2R6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 1, 2003
Last modified: November 30, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.