Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein hinderin

Gene

KIAA1328

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Competes with SMC1 for binding to SMC3. May affect the availability of SMC3 to engage in the formation of multimeric protein complexes.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Protein hinderin1 Publication
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:29248. KIAA1328.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134875219.

Polymorphism and mutation databases

BioMutaiKIAA1328.
DMDMi296434548.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 577577Protein hinderinPRO_0000312298Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei21 – 211PhosphoserineBy similarity
Modified residuei179 – 1791PhosphoserineCombined sources
Modified residuei490 – 4901PhosphoserineCombined sources
Modified residuei521 – 5211PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ86T90.
PaxDbiQ86T90.
PeptideAtlasiQ86T90.
PRIDEiQ86T90.

PTM databases

iPTMnetiQ86T90.
PhosphoSiteiQ86T90.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000150477.
CleanExiHS_KIAA1328.
ExpressionAtlasiQ86T90. baseline and differential.
GenevisibleiQ86T90. HS.

Organism-specific databases

HPAiHPA040946.

Interactioni

Subunit structurei

Interacts (via N- and C-terminal domains) with SMC3 (via central hinge region).1 Publication

Protein-protein interaction databases

BioGridi121595. 12 interactions.
IntActiQ86T90. 12 interactions.
STRINGi9606.ENSP00000280020.

Structurei

3D structure databases

ProteinModelPortaliQ86T90.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili91 – 16777Sequence analysisAdd
BLAST
Coiled coili358 – 40245Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEB0. Eukaryota.
ENOG4111J99. LUCA.
GeneTreeiENSGT00390000011152.
HOGENOMiHOG000168783.
HOVERGENiHBG108034.
InParanoidiQ86T90.
OMAiAAFWSRD.
PhylomeDBiQ86T90.
TreeFamiTF332088.

Family and domain databases

InterProiIPR032736. Hinderin.
[Graphical view]
PfamiPF15369. KIAA1328. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86T90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADVAGPSRP SAAAFWSRDF SDEEQSVVYV PGISAEGNVR SRHKLMSPKA
60 70 80 90 100
DVKLKTSRVT DASISMESLK GTGDSVDEQN SCRGEIKSAS LKDLCLEDKR
110 120 130 140 150
RIANLIKELA RVSEEKEVTE ERLKAEQESF EKKIRQLEEQ NELIIKEREA
160 170 180 190 200
LQLQYRECQE LLSLYQKYLS EQQEKLTMSL SELGAARMQE QQVSSRKSTL
210 220 230 240 250
QCSSVELDGS YLSIARPQTY YQTKQRPKSA VQDSASESLI AFRNNSLKPV
260 270 280 290 300
TLHHPKDDLD KIPSETTTCN CESPGRKPAV PTEKMPQEEL HMKECPHLKP
310 320 330 340 350
TPSQCCGHRL AADRVHDSHP TNMTPQHPKT HPESCSYCRL SWASLVHGGG
360 370 380 390 400
ALQPIETLKK QISEDRKQQL MLQKMELEIE KERLQHLLAQ QETKLLLKQQ
410 420 430 440 450
QLHQSRLDYN CLLKSNCDGW LLGTSSSIKK HQDPPNSGEN RKERKTVGFH
460 470 480 490 500
SHMKDDAQWS CQKKDTCRPQ RGTVTGVRKD ASTSPMPTGS LKDFVTTASP
510 520 530 540 550
SLQHTTSRYE TSLLDLVQSL SPNSAPKPQR YPSREAGAWN HGTFRLSPLK
560 570
STRKKMGMHR TPEELEENQI LEDIFFI
Length:577
Mass (Da):65,373
Last modified:May 18, 2010 - v2
Checksum:i0B977577ECDD5FF4
GO
Isoform 2 (identifier: Q86T90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MADVAGPSRPSAAAFWSRDF → MPDNIIVFSFMFSCVV

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):65,083
Checksum:iEEEED353DDDC1086
GO
Isoform 3 (identifier: Q86T90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-284: Missing.
     411-411: C → WLKAQALFKSRELVAEKQLTKPQELKLDMNGSDSGPS
     509-527: YETSLLDLVQSLSPNSAPK → PGISTKICFLSNHFFILFS
     528-577: Missing.

Note: No experimental confirmation available.
Show »
Length:279
Mass (Da):31,620
Checksum:iD118E23F1E51E886
GO
Isoform 4 (identifier: Q86T90-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-284: Missing.
     412-413: LL → SE
     414-577: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,978
Checksum:i05AD9DAE951A194C
GO

Sequence cautioni

The sequence BAA92566 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti62 – 621A → V in CAD89947 (PubMed:17974005).Curated
Sequence conflicti76 – 761V → A in CAD89947 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti383 – 3831R → C.
Corresponds to variant rs12326301 [ dbSNP | Ensembl ].
VAR_037483

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 284284Missing in isoform 3 and isoform 4. 1 PublicationVSP_029809Add
BLAST
Alternative sequencei1 – 2020MADVA…WSRDF → MPDNIIVFSFMFSCVV in isoform 2. 1 PublicationVSP_029810Add
BLAST
Alternative sequencei411 – 4111C → WLKAQALFKSRELVAEKQLT KPQELKLDMNGSDSGPS in isoform 3. 1 PublicationVSP_029811
Alternative sequencei412 – 4132LL → SE in isoform 4. 1 PublicationVSP_029812
Alternative sequencei414 – 577164Missing in isoform 4. 1 PublicationVSP_029813Add
BLAST
Alternative sequencei509 – 52719YETSL…NSAPK → PGISTKICFLSNHFFILFS in isoform 3. 1 PublicationVSP_029814Add
BLAST
Alternative sequencei528 – 57750Missing in isoform 3. 1 PublicationVSP_029815Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037749 mRNA. Translation: BAA92566.2. Different initiation.
AL832625 mRNA. Translation: CAD89947.1.
AC009854 Genomic DNA. No translation available.
AC015961 Genomic DNA. No translation available.
AC016493 Genomic DNA. No translation available.
BC008670 mRNA. Translation: AAH08670.1.
BC037903 mRNA. Translation: AAH37903.1.
CCDSiCCDS45855.1. [Q86T90-1]
RefSeqiNP_065827.1. NM_020776.1. [Q86T90-1]
XP_005258374.1. XM_005258317.3. [Q86T90-2]
UniGeneiHs.4045.
Hs.586976.

Genome annotation databases

EnsembliENST00000280020; ENSP00000280020; ENSG00000150477. [Q86T90-1]
ENST00000586135; ENSP00000467507; ENSG00000150477. [Q86T90-3]
ENST00000586501; ENSP00000470371; ENSG00000150477. [Q86T90-4]
ENST00000591619; ENSP00000465550; ENSG00000150477. [Q86T90-2]
GeneIDi57536.
KEGGihsa:57536.
UCSCiuc002kzz.4. human. [Q86T90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037749 mRNA. Translation: BAA92566.2. Different initiation.
AL832625 mRNA. Translation: CAD89947.1.
AC009854 Genomic DNA. No translation available.
AC015961 Genomic DNA. No translation available.
AC016493 Genomic DNA. No translation available.
BC008670 mRNA. Translation: AAH08670.1.
BC037903 mRNA. Translation: AAH37903.1.
CCDSiCCDS45855.1. [Q86T90-1]
RefSeqiNP_065827.1. NM_020776.1. [Q86T90-1]
XP_005258374.1. XM_005258317.3. [Q86T90-2]
UniGeneiHs.4045.
Hs.586976.

3D structure databases

ProteinModelPortaliQ86T90.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121595. 12 interactions.
IntActiQ86T90. 12 interactions.
STRINGi9606.ENSP00000280020.

PTM databases

iPTMnetiQ86T90.
PhosphoSiteiQ86T90.

Polymorphism and mutation databases

BioMutaiKIAA1328.
DMDMi296434548.

Proteomic databases

MaxQBiQ86T90.
PaxDbiQ86T90.
PeptideAtlasiQ86T90.
PRIDEiQ86T90.

Protocols and materials databases

DNASUi57536.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280020; ENSP00000280020; ENSG00000150477. [Q86T90-1]
ENST00000586135; ENSP00000467507; ENSG00000150477. [Q86T90-3]
ENST00000586501; ENSP00000470371; ENSG00000150477. [Q86T90-4]
ENST00000591619; ENSP00000465550; ENSG00000150477. [Q86T90-2]
GeneIDi57536.
KEGGihsa:57536.
UCSCiuc002kzz.4. human. [Q86T90-1]

Organism-specific databases

CTDi57536.
GeneCardsiKIAA1328.
HGNCiHGNC:29248. KIAA1328.
HPAiHPA040946.
MIMi616480. gene.
neXtProtiNX_Q86T90.
PharmGKBiPA134875219.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEB0. Eukaryota.
ENOG4111J99. LUCA.
GeneTreeiENSGT00390000011152.
HOGENOMiHOG000168783.
HOVERGENiHBG108034.
InParanoidiQ86T90.
OMAiAAFWSRD.
PhylomeDBiQ86T90.
TreeFamiTF332088.

Miscellaneous databases

ChiTaRSiKIAA1328. human.
GenomeRNAii57536.
PROiQ86T90.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000150477.
CleanExiHS_KIAA1328.
ExpressionAtlasiQ86T90. baseline and differential.
GenevisibleiQ86T90. HS.

Family and domain databases

InterProiIPR032736. Hinderin.
[Graphical view]
PfamiPF15369. KIAA1328. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiK1328_HUMAN
AccessioniPrimary (citable) accession number: Q86T90
Secondary accession number(s): Q05DL0, Q49AG6, Q9P2L8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.