Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 605

Gene

ZNF605

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri169 – 19123C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri477 – 49923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri505 – 52723C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri533 – 55523C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri561 – 58323C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri589 – 61123C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri617 – 63923C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 605
Gene namesi
Name:ZNF605
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:28068. ZNF605.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134901606.

Polymorphism and mutation databases

BioMutaiZNF605.
DMDMi74762445.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 641641Zinc finger protein 605PRO_0000234594Add
BLAST

Proteomic databases

PaxDbiQ86T29.
PeptideAtlasiQ86T29.
PRIDEiQ86T29.

PTM databases

iPTMnetiQ86T29.
PhosphoSiteiQ86T29.

Expressioni

Gene expression databases

BgeeiENSG00000196458.
CleanExiHS_ZNF605.
GenevisibleiQ86T29. HS.

Organism-specific databases

HPAiHPA061970.
HPA062655.

Interactioni

Protein-protein interaction databases

BioGridi941286. 1 interaction.
STRINGi9606.ENSP00000376135.

Structurei

3D structure databases

ProteinModelPortaliQ86T29.
SMRiQ86T29. Positions 4-42, 91-639.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 7772KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 17 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri169 – 19123C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri197 – 21923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri225 – 24723C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri253 – 27523C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri281 – 30323C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri309 – 33123C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri337 – 35923C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri365 – 38723C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri393 – 41523C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri421 – 44323C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri449 – 47123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri477 – 49923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri505 – 52723C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri533 – 55523C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri561 – 58323C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri589 – 61123C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri617 – 63923C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129694.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ86T29.
KOiK09228.
OMAiWKPQLLR.
OrthoDBiEOG091G02KC.
PhylomeDBiQ86T29.
TreeFamiTF350805.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 17 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 5 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86T29-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIQSQISFED VAVDFTLEEW QLLNPTQKNL YRDVMLENYS NLVFLEVWLD
60 70 80 90 100
NPKMWLRDNQ DNLKSMERGH KYDVFGKIFN SSINIVHVGL RSHKCGTGEK
110 120 130 140 150
SLKCPFDLLI PKNNCERKKI DELNKKLLFC IKPGRTHGGI KYCDCSTCRK
160 170 180 190 200
SSNEEPWLTA NHITHTGVYL CMECGRFFNK KSQLVIHQRT HTGEKPYQCS
210 220 230 240 250
ECGKAFSQKS LLTVHQRTHS GEKPHGCSEC QKAFSRKSLL ILHQRIHTGE
260 270 280 290 300
KPYGCSECGK AFSRKSQLKR HQITHTIEKP YSCSECGKAF SQKLKLITHQ
310 320 330 340 350
RAHTGEKPYP CSHCGKAFFW KSQLITHQRT HTGKKPYGCG ECQKAFSRNS
360 370 380 390 400
LLIRHQRIHT GEKPYECNEC GEAFIRKPQL IKHQITHTGE KNYRCSDCEE
410 420 430 440 450
AFFKKSELIR HQKIHLGEKP YGCIQCGKTF FGKSQLLTHH RTHTGEKPYE
460 470 480 490 500
CSECGKAFTQ KSSLISHQRT HTGEKPYECS ECRKTFSEKS SLIHHQRTHT
510 520 530 540 550
GEKPFECSEC RKAFAWKPQL LRHQRIHTGE KPYECSECGK AFVQKVQLIK
560 570 580 590 600
HQRNHTGEKT YGCSDCAKAF FEKAQLIIHQ RIHTGERPYK CGECGKSFTR
610 620 630 640
KSHLMRHQRI HTGDKYYGCN ECGTTFNRKS QLMIHQRNHI I
Length:641
Mass (Da):74,376
Last modified:June 1, 2003 - v1
Checksum:i473B29D31BA84F9C
GO
Isoform 2 (identifier: Q86T29-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: L → LGFQILKPDAMFKLEQQDPWIIGQEILNQNFS

Show »
Length:672
Mass (Da):78,007
Checksum:iC502A7DE92303B85
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti580 – 5801Q → R in CAD89946 (PubMed:17974005).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei45 – 451L → LGFQILKPDAMFKLEQQDPW IIGQEILNQNFS in isoform 2. 1 PublicationVSP_043213

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122878 mRNA. Translation: BAG53776.1.
AL832191 mRNA. Translation: CAD91163.1.
AL832623 mRNA. Translation: CAD89946.1.
AC073911 Genomic DNA. No translation available.
AC127070 Genomic DNA. No translation available.
CH471218 Genomic DNA. Translation: EAW54805.1.
CH471218 Genomic DNA. Translation: EAW54806.1.
CH471218 Genomic DNA. Translation: EAW54807.1.
CCDSiCCDS31938.1. [Q86T29-1]
CCDS53850.1. [Q86T29-2]
RefSeqiNP_001158187.1. NM_001164715.1. [Q86T29-2]
NP_899061.1. NM_183238.3. [Q86T29-1]
UniGeneiHs.29698.

Genome annotation databases

EnsembliENST00000360187; ENSP00000353314; ENSG00000196458. [Q86T29-1]
ENST00000392321; ENSP00000376135; ENSG00000196458. [Q86T29-2]
GeneIDi100289635.
KEGGihsa:100289635.
UCSCiuc001ulh.4. human. [Q86T29-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122878 mRNA. Translation: BAG53776.1.
AL832191 mRNA. Translation: CAD91163.1.
AL832623 mRNA. Translation: CAD89946.1.
AC073911 Genomic DNA. No translation available.
AC127070 Genomic DNA. No translation available.
CH471218 Genomic DNA. Translation: EAW54805.1.
CH471218 Genomic DNA. Translation: EAW54806.1.
CH471218 Genomic DNA. Translation: EAW54807.1.
CCDSiCCDS31938.1. [Q86T29-1]
CCDS53850.1. [Q86T29-2]
RefSeqiNP_001158187.1. NM_001164715.1. [Q86T29-2]
NP_899061.1. NM_183238.3. [Q86T29-1]
UniGeneiHs.29698.

3D structure databases

ProteinModelPortaliQ86T29.
SMRiQ86T29. Positions 4-42, 91-639.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi941286. 1 interaction.
STRINGi9606.ENSP00000376135.

PTM databases

iPTMnetiQ86T29.
PhosphoSiteiQ86T29.

Polymorphism and mutation databases

BioMutaiZNF605.
DMDMi74762445.

Proteomic databases

PaxDbiQ86T29.
PeptideAtlasiQ86T29.
PRIDEiQ86T29.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360187; ENSP00000353314; ENSG00000196458. [Q86T29-1]
ENST00000392321; ENSP00000376135; ENSG00000196458. [Q86T29-2]
GeneIDi100289635.
KEGGihsa:100289635.
UCSCiuc001ulh.4. human. [Q86T29-1]

Organism-specific databases

CTDi100289635.
GeneCardsiZNF605.
HGNCiHGNC:28068. ZNF605.
HPAiHPA061970.
HPA062655.
neXtProtiNX_Q86T29.
PharmGKBiPA134901606.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129694.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ86T29.
KOiK09228.
OMAiWKPQLLR.
OrthoDBiEOG091G02KC.
PhylomeDBiQ86T29.
TreeFamiTF350805.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF605. human.
GenomeRNAii100289635.
PROiQ86T29.

Gene expression databases

BgeeiENSG00000196458.
CleanExiHS_ZNF605.
GenevisibleiQ86T29. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 17 hits.
InterProiIPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 5 hits.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN605_HUMAN
AccessioniPrimary (citable) accession number: Q86T29
Secondary accession number(s): B3KVG4, D3DXJ0, Q86T91
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: June 1, 2003
Last modified: September 7, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.