Q86SX3 (CN080_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C14orf80 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 495 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence caution | The sequence CAD62351.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAD62363.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAD62611.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86SX3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86SX3-2) The sequence of this isoform differs from the canonical sequence as follows: 196-297: Missing. | ||||||
| Isoform 3 (identifier: Q86SX3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-49: MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA → MSGQRGDWVQ 196-297: Missing. | ||||||
| Isoform 4 (identifier: Q86SX3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-126: Missing. 144-195: Missing. 229-297: Missing. | ||||||
| Isoform 5 (identifier: Q86SX3-5) The sequence of this isoform differs from the canonical sequence as follows: 1-49: MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEA → MSGQRGDW 196-297: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 495 | 495 | Uncharacterized protein C14orf80 | PRO_0000330692 | |||||
Regions | |||||||||
| Coiled coil | 355 – 387 | 33 | Potential | ||||||
| Coiled coil | 452 – 480 | 29 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 126 | 126 | Missing in isoform 4. | VSP_033062 | |||||
| Alternative sequence | 1 – 49 | 49 | MGRRR…DRPEA → MSGQRGDWVQ in isoform 3. | VSP_033063 | |||||
| Alternative sequence | 1 – 49 | 49 | MGRRR…DRPEA → MSGQRGDW in isoform 5. | VSP_045690 | |||||
| Alternative sequence | 144 – 195 | 52 | Missing in isoform 4. | VSP_033064 | |||||
| Alternative sequence | 196 – 297 | 102 | Missing in isoform 2, isoform 3 and isoform 5. | VSP_033065 | |||||
| Alternative sequence | 229 – 297 | 69 | Missing in isoform 4. | VSP_033066 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 5). Tissue: Cervix carcinoma and Placenta. |
| [2] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Uterus. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 327-495. Tissue: Spleen. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BX161477 mRNA. Translation: CAD61932.1. BX248038 mRNA. Translation: CAD62351.1. Different initiation. BX248074 mRNA. Translation: CAD62363.1. Different initiation. BX248283 mRNA. Translation: CAD62611.1. Different initiation. AL928654 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW81929.1. BC016028 mRNA. Translation: AAH16028.1. AK024506 mRNA. Translation: BAB15796.1. |
| IPI | IPI00384141. IPI00384142. IPI00742988. IPI00791279. IPI01021027. |
| RefSeq | NP_001128348.1. NM_001134876.1. NP_001128349.1. NM_001134877.1. NP_001185912.1. NM_001198983.1. |
| UniGene | Hs.720306. |
3D structure databases | |
| ProteinModelPortal | Q86SX3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q86SX3. 1 interaction. |
| STRING | 9606.ENSP00000376307. |
PTM databases | |
| PhosphoSite | Q86SX3. |
Polymorphism databases | |
| DMDM | 187470846. |
Proteomic databases | |
| PaxDb | Q86SX3. |
| PRIDE | Q86SX3. |
Protocols and materials databases | |
| DNASU | 283643. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000329886; ENSP00000333010; ENSG00000185347. ENST00000334656; ENSP00000333959; ENSG00000185347. ENST00000354560; ENSP00000346568; ENSG00000185347. ENST00000392523; ENSP00000376308; ENSG00000185347. ENST00000392527; ENSP00000376312; ENSG00000185347. ENST00000450383; ENSP00000391436; ENSG00000185347. |
| GeneID | 283643. |
| KEGG | hsa:283643. |
| UCSC | uc001yrj.3. human. uc001yrm.3. human. uc001yro.3. human. uc010tys.2. human. |
Organism-specific databases | |
| CTD | 283643. |
| GeneCards | GC14P105953. |
| HGNC | HGNC:20127. C14orf80. |
| HPA | HPA039050. |
| neXtProt | NX_Q86SX3. |
| PharmGKB | PA134885988. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG43941. |
| HOGENOM | HOG000111821. |
| HOVERGEN | HBG107730. |
| InParanoid | Q86SX3. |
| OMA | FWQWMDT. |
Gene expression databases | |
| ArrayExpress | Q86SX3. |
| Bgee | Q86SX3. |
| Genevestigator | Q86SX3. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 283643. |
| NextBio | 94117. |
Entry information
| Entry name | CN080_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86SX3 Secondary accession number(s): B5MDG3 Q9H7H4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |

Clusters with
