Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Immunoglobulin-like domain-containing receptor 1

Gene

ILDR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Putative membrane receptor.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor

Names & Taxonomyi

Protein namesi
Recommended name:
Immunoglobulin-like domain-containing receptor 1
Gene namesi
Name:ILDR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000145103.12
HGNCiHGNC:28741 ILDR1
MIMi609739 gene
neXtProtiNX_Q86SU0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 167ExtracellularSequence analysisAdd BLAST144
Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Topological domaini189 – 546CytoplasmicSequence analysisAdd BLAST358

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Deafness, autosomal recessive, 42 (DFNB42)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA prelingual, non-progressive form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
See also OMIM:609646
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06535297R → Q in DFNB42. 1 PublicationCorresponds to variant dbSNP:rs771818841Ensembl.1
Natural variantiVAR_065353453R → Q in DFNB42; uncertain pathological significance. 1 PublicationCorresponds to variant dbSNP:rs372564314Ensembl.1

Keywords - Diseasei

Deafness, Disease mutation, Non-syndromic deafness

Organism-specific databases

DisGeNETi286676
MalaCardsiILDR1
MIMi609646 phenotype
OpenTargetsiENSG00000145103
Orphaneti90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBiPA134883110

Polymorphism and mutation databases

BioMutaiILDR1
DMDMi110279019

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000024530424 – 546Immunoglobulin-like domain-containing receptor 1Add BLAST523

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi45 ↔ 145By similarity
Modified residuei499PhosphoserineBy similarity1
Modified residuei501PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDbiQ86SU0
PeptideAtlasiQ86SU0
PRIDEiQ86SU0

PTM databases

iPTMnetiQ86SU0
PhosphoSitePlusiQ86SU0

Expressioni

Tissue specificityi

Mainly expressed in prostate and to a lower extent in testis, pancreas, kidney, heart and liver.1 Publication

Gene expression databases

BgeeiENSG00000145103
CleanExiHS_ILDR1
GenevisibleiQ86SU0 HS

Organism-specific databases

HPAiHPA018207

Interactioni

Subunit structurei

Homooligomer.1 Publication

GO - Molecular functioni

  • identical protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi130413, 4 interactors
STRINGi9606.ENSP00000345667

Structurei

3D structure databases

ProteinModelPortaliQ86SU0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 162Ig-like V-typeAdd BLAST139

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi188 – 212Cys-richAdd BLAST25
Compositional biasi431 – 466Arg-richAdd BLAST36

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFI2 Eukaryota
ENOG4110276 LUCA
GeneTreeiENSGT00430000030906
HOGENOMiHOG000294105
HOVERGENiHBG060497
InParanoidiQ86SU0
OMAiWPEEKPP
OrthoDBiEOG091G0875
PhylomeDBiQ86SU0
TreeFamiTF330877

Family and domain databases

InterProiView protein in InterPro
IPR036179 Ig-like_dom_sf
IPR003599 Ig_sub
IPR008664 LISCH7
PfamiView protein in Pfam
PF05624 LSR, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86SU0-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWPKLPAPW LLLCTWLPAG CLSLLVTVQH TERYVTLFAS IILKCDYTTS
60 70 80 90 100
AQLQDVVVTW RFKSFCKDPI FDYYSASYQA ALSLGQDPSN DCNDNQREVR
110 120 130 140 150
IVAQRRGQNE PVLGVDYRQR KITIQNRADL VINEVMWWDH GVYYCTIEAP
160 170 180 190 200
GDTSGDPDKE VKLIVLHWLT VIFIILGALL LLLLIGVCWC QCCPQYCCCY
210 220 230 240 250
IRCPCCPAHC CCPEEALARH RYMKQAQALG PQMMGKPLYW GADRSSQVSS
260 270 280 290 300
YPMHPLLQRD LSLPSSLPQM PMTQTTNQPP IANGVLEYLE KELRNLNLAQ
310 320 330 340 350
PLPPDLKGRF GHPCSMLSSL GSEVVERRII HLPPLIRDLS SSRRTSDSLH
360 370 380 390 400
QQWLTPIPSR PWDLREGRSH HHYPDFHQEL QDRGPKSWAL ERRELDPSWS
410 420 430 440 450
GRHRSSRLNG SPIHWSDRDS LSDVPSSSEA RWRPSHPPFR SRCQERPRRP
460 470 480 490 500
SPRESTQRHG RRRRHRSYSP PLPSGLSSWS SEEDKERQPQ SWRAHRRGSH
510 520 530 540
SPHWPEEKPP SYRSLDITPG KNSRKKGSVE RRSEKDSSHS GRSVVI
Length:546
Mass (Da):62,815
Last modified:July 11, 2006 - v2
Checksum:iE2FDF8AD9032B5D7
GO
Isoform 2 (identifier: Q86SU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-259: Missing.

Show »
Length:502
Mass (Da):57,775
Checksum:iD686BE1DF8FEF449
GO
Isoform 3 (identifier: Q86SU0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     260-265: DLSLPS → ASRRCQ
     266-546: Missing.

Note: No experimental confirmation available.
Show »
Length:265
Mass (Da):30,292
Checksum:i21A71B9E2447538A
GO
Isoform 4 (identifier: Q86SU0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-209: Missing.
     324-329: VVERRI → NQIEEF
     330-546: Missing.

Note: No experimental confirmation available.
Show »
Length:211
Mass (Da):23,744
Checksum:i9249AB2357177750
GO
Isoform 5 (identifier: Q86SU0-5) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     127-127: R → P
     128-216: Missing.

Show »
Length:457
Mass (Da):52,763
Checksum:iB7C346C9B9F90235
GO
Isoform 6 (identifier: Q86SU0-6) [UniParc]FASTAAdd to basket
Also known as: Alpha'

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MAWPKLPAPWLLLCTWLPA → MAGNIFCPFALFFLPMSRVGHLQHFLLLLAL
     216-259: Missing.

Show »
Length:514
Mass (Da):59,085
Checksum:i3E41406859C8F23E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06535297R → Q in DFNB42. 1 PublicationCorresponds to variant dbSNP:rs771818841Ensembl.1
Natural variantiVAR_079750357I → V1 Publication1
Natural variantiVAR_065353453R → Q in DFNB42; uncertain pathological significance. 1 PublicationCorresponds to variant dbSNP:rs372564314Ensembl.1
Natural variantiVAR_065354463R → C1 PublicationCorresponds to variant dbSNP:rs778163752Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0196791 – 19MAWPK…TWLPA → MAGNIFCPFALFFLPMSRVG HLQHFLLLLAL in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01968092 – 209Missing in isoform 4. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_019681127R → P in isoform 5. 1 Publication1
Alternative sequenceiVSP_019682128 – 216Missing in isoform 5. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_019683216 – 259Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_019684260 – 265DLSLPS → ASRRCQ in isoform 3. 1 Publication6
Alternative sequenceiVSP_019685266 – 546Missing in isoform 3. 1 PublicationAdd BLAST281
Alternative sequenceiVSP_019686324 – 329VVERRI → NQIEEF in isoform 4. 1 Publication6
Alternative sequenceiVSP_019687330 – 546Missing in isoform 4. 1 PublicationAdd BLAST217

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY672837 mRNA No translation available.
AY672838 mRNA No translation available.
AY672839 mRNA No translation available.
AY134857 mRNA Translation: AAN10256.1
AK129974 mRNA Translation: BAC85264.1
BC044240 mRNA Translation: AAH44240.1
CCDSiCCDS3008.1 [Q86SU0-2]
CCDS56270.1 [Q86SU0-5]
CCDS56271.1 [Q86SU0-1]
RefSeqiNP_001186728.1, NM_001199799.1 [Q86SU0-1]
NP_001186729.1, NM_001199800.1 [Q86SU0-5]
NP_787120.1, NM_175924.3 [Q86SU0-2]
XP_005247446.1, XM_005247389.4 [Q86SU0-6]
UniGeneiHs.98484

Genome annotation databases

EnsembliENST00000273691; ENSP00000273691; ENSG00000145103 [Q86SU0-2]
ENST00000344209; ENSP00000345667; ENSG00000145103 [Q86SU0-1]
ENST00000393631; ENSP00000377251; ENSG00000145103 [Q86SU0-5]
ENST00000462014; ENSP00000419414; ENSG00000145103 [Q86SU0-6]
GeneIDi286676
KEGGihsa:286676
UCSCiuc003eeq.4 human [Q86SU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiILDR1_HUMAN
AccessioniPrimary (citable) accession number: Q86SU0
Secondary accession number(s): Q6ZP61, Q7Z578
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: April 25, 2018
This is version 133 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health