Q86SQ9 (DHDDS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dehydrodolichyl diphosphate synthase Short name=Dedol-PP synthase EC=2.5.1.- Alternative name(s): Cis-isoprenyltransferase Short name=CIT Short name=Cis-IPTase Epididymis tissue protein Li 189m | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 333 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein. Ref.7 |
| Pathway | |
| Subunit structure | Interacts with NUS1/NgBR, the interaction is required for efficient activity. Interacts with NPC2. Ref.8 |
| Subcellular location | Endoplasmic reticulum membrane; Peripheral membrane protein. Note: colocalizes with calnexin. Ref.7 |
| Tissue specificity | Expressed at high levels in testis and kidney. Expressed in epididymis (at protein level). Slightly expressed in heart, spleen and thymus. Ref.2 |
| Involvement in disease | Retinitis pigmentosa 59 (RP59) [MIM:613861]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. |
| Sequence similarities | Belongs to the UPP synthase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Retinitis pigmentosa |
| Molecular function | Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein glycosylation Inferred from electronic annotation. Source: UniProtKB-UniPathway |
| Cellular_component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | transferase activity, transferring alkyl or aryl (other than methyl) groups Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q86SQ9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q86SQ9-2) The sequence of this isoform differs from the canonical sequence as follows: 255-255: Q → QQ | ||||||
| Isoform 3 (identifier: Q86SQ9-3) The sequence of this isoform differs from the canonical sequence as follows: 109-147: Missing. | ||||||
| Note: May be due to exon skipping. | ||||||
| Isoform 4 (identifier: Q86SQ9-4) The sequence of this isoform differs from the canonical sequence as follows: 147-181: KCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPS → N | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 333 | 333 | Dehydrodolichyl diphosphate synthase | PRO_0000123749 | |||||
Natural variations | |||||||||
| Alternative sequence | 109 – 147 | 39 | Missing in isoform 3. | VSP_010030 | |||||
| Alternative sequence | 147 – 181 | 35 | KCFLN…LLDPS → N in isoform 4. | VSP_045007 | |||||
| Alternative sequence | 255 | 1 | Q → QQ in isoform 2. | VSP_010031 | |||||
| Natural variant | 42 | 1 | K → E in RP59. Ref.9 | VAR_065356 | |||||
| Natural variant | 253 | 1 | V → M. Ref.2 Ref.3 Ref.6 Corresponds to variant rs3816539 [ dbSNP | Ensembl ]. | VAR_028088 | |||||
Experimental info | |||||||||
| Sequence conflict | 151 | 1 | N → Y in BAB14439. Ref.3 | ||||||
| Sequence conflict | 277 | 1 | V → E in AAH34152. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of human dehydrodolichyl diphosphate synthase gene." Endo S., Zhang Y.-W., Takahashi S., Koyama T. Biochim. Biophys. Acta 1625:291-295(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins." Li J., Liu F., Wang H., Liu X., Liu J., Li N., Wan F., Wang W., Zhang C., Jin S., Liu J., Zhu P., Liu Y. Mol. Cell. Proteomics 9:2517-2528(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-253, TISSUE SPECIFICITY. Tissue: Epididymis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT MET-253. Tissue: Teratocarcinoma and Thyroid. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT MET-253. Tissue: Lung, Muscle and Placenta. |
| [7] | "Identification and characterization of a cDNA encoding a long-chain cis-isoprenyltranferase involved in dolichyl monophosphate biosynthesis in the ER of brain cells." Shridas P., Rush J.S., Waechter C.J. Biochem. Biophys. Res. Commun. 312:1349-1356(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [8] | "Nogo-B receptor is necessary for cellular dolichol biosynthesis and protein N-glycosylation." Harrison K.D., Park E.J., Gao N., Kuo A., Rush J.S., Waechter C.J., Lehrman M.A., Sessa W.C. EMBO J. 30:2490-2500(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NUS1. |
| [9] | "Whole-exome sequencing links a variant in DHDDS to retinitis pigmentosa." Zuchner S., Dallman J., Wen R., Beecham G., Naj A., Farooq A., Kohli M.A., Whitehead P.L., Hulme W., Konidari I., Edwards Y.J., Cai G., Peter I., Seo D., Buxbaum J.D., Haines J.L., Blanton S., Young J. Pericak-Vance M.A.Am. J. Hum. Genet. 88:201-206(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RP59 GLU-42. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB090852 mRNA. Translation: BAC57588.1. GU727641 mRNA. Translation: ADU87642.1. AK023164 mRNA. Translation: BAB14439.1. AK297134 mRNA. Translation: BAH12505.1. AK316485 mRNA. Translation: BAH14856.1. AL513365 Genomic DNA. Translation: CAI21495.1. CH471059 Genomic DNA. Translation: EAX07806.1. CH471059 Genomic DNA. Translation: EAX07808.1. CH471059 Genomic DNA. Translation: EAX07809.1. CH471059 Genomic DNA. Translation: EAX07810.1. CH471059 Genomic DNA. Translation: EAX07811.1. CH471059 Genomic DNA. Translation: EAX07812.1. BC003643 mRNA. Translation: AAH03643.1. BC004117 mRNA. Translation: AAH04117.1. BC034152 mRNA. Translation: AAH34152.1. |
| IPI | IPI00410097. IPI00410099. IPI00514787. IPI00922374. |
| RefSeq | NP_001230493.1. NM_001243564.1. NP_001230494.1. NM_001243565.1. NP_079163.2. NM_024887.3. NP_995583.1. NM_205861.2. |
| UniGene | Hs.369385. |
3D structure databases | |
| ProteinModelPortal | Q86SQ9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000353104. |
PTM databases | |
| PhosphoSite | Q86SQ9. |
Polymorphism databases | |
| DMDM | 116241329. |
Proteomic databases | |
| PaxDb | Q86SQ9. |
| PRIDE | Q86SQ9. |
Protocols and materials databases | |
| DNASU | 79947. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000236342; ENSP00000236342; ENSG00000117682. ENST00000360009; ENSP00000353104; ENSG00000117682. ENST00000525682; ENSP00000434984; ENSG00000117682. ENST00000526219; ENSP00000434219; ENSG00000117682. |
| GeneID | 79947. |
| KEGG | hsa:79947. |
| UCSC | uc001bmk.3. human. uc001bml.3. human. uc001bmn.3. human. |
Organism-specific databases | |
| CTD | 79947. |
| GeneCards | GC01P026758. |
| HGNC | HGNC:20603. DHDDS. |
| HPA | HPA026721. HPA026727. |
| MIM | 608172. gene. 613861. phenotype. |
| neXtProt | NX_Q86SQ9. |
| Orphanet | 791. Retinitis pigmentosa. |
| PharmGKB | PA134867119. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0020. |
| HOVERGEN | HBG051350. |
| KO | K11778. |
| OMA | IAYSELF. |
Enzyme and pathway databases | |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | Q86SQ9. |
| Bgee | Q86SQ9. |
| CleanEx | HS_DHDDS. |
| Genevestigator | Q86SQ9. |
| GermOnline | ENSG00000117682. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.1180.10. 1 hit. |
| InterPro | IPR001441. UPP_synth-like. IPR018520. UPP_synth-like_CS. [Graphical view] |
| PANTHER | PTHR10291. PTHR10291. 1 hit. |
| Pfam | PF01255. Prenyltransf. 1 hit. [Graphical view] |
| SUPFAM | SSF64005. UPP_synth. 1 hit. |
| TIGRFAMs | TIGR00055. uppS. 1 hit. |
| PROSITE | PS01066. UPP_SYNTHASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79947. |
| NextBio | 69906. |
| SOURCE | Search... |
Entry information
| Entry name | DHDDS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q86SQ9 Secondary accession number(s): B7Z4B9 Q9H905 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
