Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lysozyme g-like protein 2

Gene

LYG2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May act as a potent antibacterial protein that may play a role in the innate immunity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei105By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Enzyme and pathway databases

BRENDAi3.2.1.17. 2681.

Protein family/group databases

CAZyiGH23. Glycoside Hydrolase Family 23.

Names & Taxonomyi

Protein namesi
Recommended name:
Lysozyme g-like protein 2 (EC:3.2.1.-)
Gene namesi
Name:LYG2
Synonyms:LYGH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:29615. LYG2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000185674.
PharmGKBiPA162394717.

Polymorphism and mutation databases

BioMutaiLYG2.
DMDMi47117209.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001202520 – 212Lysozyme g-like protein 2Add BLAST193

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi39 ↔ 92By similarity
Disulfide bondi53 ↔ 61By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ86SG7.
PeptideAtlasiQ86SG7.
PRIDEiQ86SG7.

PTM databases

iPTMnetiQ86SG7.
PhosphoSitePlusiQ86SG7.

Expressioni

Tissue specificityi

Strong expression detected in the eye and weak expression in the testis. No expression is observed in any other tissues.1 Publication

Gene expression databases

BgeeiENSG00000185674.
CleanExiHS_LYG2.
ExpressionAtlasiQ86SG7. baseline and differential.
GenevisibleiQ86SG7. HS.

Organism-specific databases

HPAiHPA039179.

Interactioni

Protein-protein interaction databases

BioGridi129047. 27 interactors.
STRINGi9606.ENSP00000327533.

Structurei

3D structure databases

ProteinModelPortaliQ86SG7.
SMRiQ86SG7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyl hydrolase 23 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IJVN. Eukaryota.
ENOG4111M7T. LUCA.
GeneTreeiENSGT00390000017614.
HOGENOMiHOG000247036.
HOVERGENiHBG006299.
InParanoidiQ86SG7.
OMAiGDIMTME.
OrthoDBiEOG091G0LPR.
PhylomeDBiQ86SG7.
TreeFamiTF329826.

Family and domain databases

InterProiIPR002152. Glyco_hydro_23.
IPR023346. Lysozyme-like_dom.
[Graphical view]
PIRSFiPIRSF001065. Lysozyme_g. 1 hit.
PRINTSiPR00749. LYSOZYMEG.
SUPFAMiSSF53955. SSF53955. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q86SG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSSVVFWGL IALIGTSRGS YPFSHSMKPH LHPRLYHGCY GDIMTMKTSG
60 70 80 90 100
ATCDANSVMN CGIRGSEMFA EMDLRAIKPY QTLIKEVGQR HCVDPAVIAA
110 120 130 140 150
IISRESHGGS VLQDGWDHRG LKFGLMQLDK QTYHPVGAWD SKEHLSQATG
160 170 180 190 200
ILTERIKAIQ KKFPTWSVAQ HLKGGLSAFK SGIEAIATPS DIDNDFVNDI
210
IARAKFYKRQ SF
Length:212
Mass (Da):23,498
Last modified:May 10, 2004 - v2
Checksum:iF1D36C905373D625
GO
Isoform 2 (identifier: Q86SG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-212: GLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF → FFLL

Note: No experimental confirmation available.
Show »
Length:178
Mass (Da):19,830
Checksum:i779CB5CBE192AC10
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8W → G in AAK16605 (Ref. 4) Curated1
Sequence conflicti8W → G in AAO32945 (Ref. 4) Curated1
Sequence conflicti19G → S in AAK16605 (Ref. 4) Curated1
Sequence conflicti19G → S in AAO32945 (Ref. 4) Curated1
Sequence conflicti55A → P in AAK16605 (Ref. 4) Curated1
Sequence conflicti55A → P in AAO32945 (Ref. 4) Curated1
Sequence conflicti175 – 182GLSAFKSG → RLYSEYFY (Ref. 4) Curated8

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056329175 – 212GLSAF…KRQSF → FFLL in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026238 mRNA. Translation: AAK16605.1.
AC079447 Genomic DNA. Translation: AAX93255.1.
BC100882 mRNA. Translation: AAI00883.1.
BC100883 mRNA. Translation: AAI00884.1.
BC100884 mRNA. Translation: AAI00885.1.
BC100885 mRNA. Translation: AAI00886.1.
AF323919 mRNA. Translation: AAO32945.1.
CCDSiCCDS2042.1. [Q86SG7-1]
RefSeqiNP_783862.2. NM_175735.3. [Q86SG7-1]
XP_016859240.1. XM_017003751.1. [Q86SG7-1]
UniGeneiHs.436468.

Genome annotation databases

EnsembliENST00000333017; ENSP00000327533; ENSG00000185674. [Q86SG7-1]
ENST00000409238; ENSP00000386939; ENSG00000185674. [Q86SG7-1]
ENST00000423800; ENSP00000390357; ENSG00000185674. [Q86SG7-2]
ENST00000626374; ENSP00000487012; ENSG00000185674. [Q86SG7-2]
GeneIDi254773.
KEGGihsa:254773.
UCSCiuc002szw.2. human. [Q86SG7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026238 mRNA. Translation: AAK16605.1.
AC079447 Genomic DNA. Translation: AAX93255.1.
BC100882 mRNA. Translation: AAI00883.1.
BC100883 mRNA. Translation: AAI00884.1.
BC100884 mRNA. Translation: AAI00885.1.
BC100885 mRNA. Translation: AAI00886.1.
AF323919 mRNA. Translation: AAO32945.1.
CCDSiCCDS2042.1. [Q86SG7-1]
RefSeqiNP_783862.2. NM_175735.3. [Q86SG7-1]
XP_016859240.1. XM_017003751.1. [Q86SG7-1]
UniGeneiHs.436468.

3D structure databases

ProteinModelPortaliQ86SG7.
SMRiQ86SG7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129047. 27 interactors.
STRINGi9606.ENSP00000327533.

Protein family/group databases

CAZyiGH23. Glycoside Hydrolase Family 23.

PTM databases

iPTMnetiQ86SG7.
PhosphoSitePlusiQ86SG7.

Polymorphism and mutation databases

BioMutaiLYG2.
DMDMi47117209.

Proteomic databases

PaxDbiQ86SG7.
PeptideAtlasiQ86SG7.
PRIDEiQ86SG7.

Protocols and materials databases

DNASUi254773.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333017; ENSP00000327533; ENSG00000185674. [Q86SG7-1]
ENST00000409238; ENSP00000386939; ENSG00000185674. [Q86SG7-1]
ENST00000423800; ENSP00000390357; ENSG00000185674. [Q86SG7-2]
ENST00000626374; ENSP00000487012; ENSG00000185674. [Q86SG7-2]
GeneIDi254773.
KEGGihsa:254773.
UCSCiuc002szw.2. human. [Q86SG7-1]

Organism-specific databases

CTDi254773.
GeneCardsiLYG2.
HGNCiHGNC:29615. LYG2.
HPAiHPA039179.
MIMi616547. gene.
neXtProtiNX_Q86SG7.
OpenTargetsiENSG00000185674.
PharmGKBiPA162394717.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJVN. Eukaryota.
ENOG4111M7T. LUCA.
GeneTreeiENSGT00390000017614.
HOGENOMiHOG000247036.
HOVERGENiHBG006299.
InParanoidiQ86SG7.
OMAiGDIMTME.
OrthoDBiEOG091G0LPR.
PhylomeDBiQ86SG7.
TreeFamiTF329826.

Enzyme and pathway databases

BRENDAi3.2.1.17. 2681.

Miscellaneous databases

GenomeRNAii254773.
PROiQ86SG7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185674.
CleanExiHS_LYG2.
ExpressionAtlasiQ86SG7. baseline and differential.
GenevisibleiQ86SG7. HS.

Family and domain databases

InterProiIPR002152. Glyco_hydro_23.
IPR023346. Lysozyme-like_dom.
[Graphical view]
PIRSFiPIRSF001065. Lysozyme_g. 1 hit.
PRINTSiPR00749. LYSOZYMEG.
SUPFAMiSSF53955. SSF53955. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiLYG2_HUMAN
AccessioniPrimary (citable) accession number: Q86SG7
Secondary accession number(s): Q496G2, Q53RW0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: November 2, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.