Q84XU2 (PPP5_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 5 EC=3.1.3.16 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 538 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 2 dephosphorylates phosphorylated phytochromes, with a preference toward Pfr forms, and enhances phytochrome-mediated photoresponses, probably by enhancing their stability and their binding affinity for light signal transducers such as NDPK2. Can use para-nitrophenylphosphate (pNPP) as substrate. Ref.7 |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 1 iron ion per subunit By similarity. Binds 1 manganese ion per subunit By similarity. |
| Enzyme regulation | Activated by arachidonic acid (AA). |
| Subunit structure | Interacts with PHYA and PHYB, mostly when they are phosphorylated and in Pfr forms. Ref.7 |
| Subcellular location | Isoform 1: Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein By similarity Ref.7. Isoform 2: Cytoplasm. Nucleus › nucleoplasm. Nucleus speckle. Note: Cytoplasmic in darkness, but translocated to the nucleus upon illumination, when associated with phytochromes into speckles. Ref.7 |
| Domain | TPR repeats are required for the binding with phytochromes. |
| Sequence similarities | Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily. Contains 3 TPR repeats. |
| Biophysicochemical properties | Kinetic parameters: Experiments have been done in the presence of 100 µM arachidonic acid (AA). KM=160 mM for pNPP (at pH 7.5 and 30 degrees Celsius) Ref.7 Vmax=22 µmol/min/mg enzyme with pNPP as substrate (at pH 7.5 and 30 degrees Celsius) |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q84XU2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q84XU2-2) The sequence of this isoform differs from the canonical sequence as follows: 157-211: GNKPRSSSMPTKTALAAVVAAVMVVAVRGFATTEILMVLVSVVLGTFWWGSFSGK → E | ||||||
| Note: Partial isoform 2 lacking TPR repeats exhibits enhanced activity at pH 7.5 with pNPP as substrate. This partial protein is in addition inhibited by okadaic acid. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 538 | 538 | Serine/threonine-protein phosphatase 5 | PRO_0000308988 | |||||
Regions | |||||||||
| Transmembrane | 163 – 183 | 21 | Helical; Potential | ||||||
| Transmembrane | 185 – 205 | 21 | Helical; Potential | ||||||
| Repeat | 13 – 46 | 34 | TPR 1 | ||||||
| Repeat | 48 – 80 | 33 | TPR 2 | ||||||
| Repeat | 81 – 114 | 34 | TPR 3 | ||||||
Sites | |||||||||
| Active site | 344 | 1 | Proton donor By similarity | ||||||
| Metal binding | 282 | 1 | Iron By similarity | ||||||
| Metal binding | 284 | 1 | Iron By similarity | ||||||
| Metal binding | 311 | 1 | Iron By similarity | ||||||
| Metal binding | 311 | 1 | Manganese By similarity | ||||||
| Metal binding | 343 | 1 | Manganese By similarity | ||||||
| Metal binding | 392 | 1 | Manganese By similarity | ||||||
| Metal binding | 467 | 1 | Manganese By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 157 – 211 | 55 | GNKPR…SFSGK → E in isoform 2. | VSP_029087 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The subcellular localization of plant protein phosphatase 5 isoforms is determined by alternative splicing." de la Fuente van Bentem S., Vossen J.H., Vermeer J.E.M., de Vroomen M.J., Gadella T.W.J. Jr., Haring M.A., Cornelissen B.J.C. Plant Physiol. 133:702-712(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ALTERNATIVE PRODUCTS. |
| [2] | "Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana." Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D., Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V., Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L., Moffat K.S., Cronin L.A. Venter J.C.Nature 402:761-768(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [4] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: cv. Columbia. |
| [5] | "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs." Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K. Shinozaki K.Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 424-538 (ISOFORMS 1 AND 2). Strain: cv. Columbia. |
| [6] | "Phy tunes: phosphorylation status and phytochrome-mediated signaling." Rubio V., Deng X.W. Cell 120:290-292(2005) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [7] | "Phytochrome-specific type 5 phosphatase controls light signal flux by enhancing phytochrome stability and affinity for a signal transducer." Ryu J.S., Kim J.-I., Kunkel T., Kim B.C., Cho D.S., Hong S.H., Kim S.-H., Fernandez A.P., Kim Y., Alonso J.M., Ecker J.R., Nagy F., Lim P.O., Song P.-S., Schaefer E., Nam H.G. Cell 120:395-406(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, BIOPHYSICOCHEMICAL PROPERTIES, ACTIVATION BY ARACHIDONIC ACID, INTERACTION WITH PHYA AND PHYB. |
| [8] | "Arabidopsis PPP family of serine/threonine phosphatases." Farkas I., Dombradi V., Miskei M., Szabados L., Koncz C. Trends Plant Sci. 12:169-176(2007) [PubMed] [Europe PMC] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY182779 mRNA. Translation: AAO26216.1. AC006931 Genomic DNA. Translation: AAD21727.2. CP002685 Genomic DNA. Translation: AEC10171.1. CP002685 Genomic DNA. Translation: AEC10172.1. AF419574 mRNA. Translation: AAL31906.1. AY080674 mRNA. Translation: AAL86350.1. BT010180 mRNA. Translation: AAQ22649.1. AK221789 mRNA. Translation: BAD93924.1. |
| IPI | IPI00542290. IPI00542877. |
| PIR | E84858. |
| RefSeq | NP_001031534.1. NM_001036457.2. NP_565985.1. NM_129842.3. |
| UniGene | At.23737. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1WAO based on UniProtKB P53041. |
| ProteinModelPortal | Q84XU2. |
| SMR | Q84XU2. Positions 10-156, 216-530. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q84XU2. 1 interaction. |
Proteomic databases | |
| PaxDb | Q84XU2. |
| PRIDE | Q84XU2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT2G42810.2; AT2G42810.2; AT2G42810. |
| GeneID | 818881. |
| KEGG | ath:AT2G42810. |
Organism-specific databases | |
| TAIR | At2g42810. |
Phylogenomic databases | |
| eggNOG | COG0639. |
| HOGENOM | HOG000172698. |
| InParanoid | Q84XU2. |
| KO | K04460. |
| OMA | GERTECA. |
| PhylomeDB | Q84XU2. |
| ProtClustDB | CLSN2688898. |
Gene expression databases | |
| ArrayExpress | Q84XU2. |
| Genevestigator | Q84XU2. |
Family and domain databases | |
| Gene3D | 1.25.40.10. 1 hit. |
| InterPro | IPR004843. Metallo_PEstase_dom. IPR013235. PPP_dom. IPR006186. Ser/Thr-sp_prot-phosphatase. IPR011236. Ser/Thr_PPase_5. IPR001440. TPR-1. IPR013026. TPR-contain_dom. IPR011990. TPR-like_helical. IPR019734. TPR_repeat. [Graphical view] |
| PANTHER | PTHR11668:SF12. PTHR11668:SF12. 1 hit. |
| Pfam | PF00149. Metallophos. 1 hit. PF08321. PPP5. 2 hits. PF00515. TPR_1. 1 hit. [Graphical view] |
| PIRSF | PIRSF033096. PPPtase_5. 1 hit. |
| PRINTS | PR00114. STPHPHTASE. |
| SMART | SM00156. PP2Ac. 1 hit. SM00028. TPR. 3 hits. [Graphical view] |
| PROSITE | PS00125. SER_THR_PHOSPHATASE. False negative. PS50005. TPR. 3 hits. PS50293. TPR_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | PPP5_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q84XU2 Secondary accession number(s): Q56X87 Q9SJH5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
