Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q811T9

- DISC1_MOUSE

UniProt

Q811T9 - DISC1_MOUSE

Protein

Disrupted in schizophrenia 1 homolog

Gene

Disc1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 2 (13 Jun 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation.4 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. canonical Wnt signaling pathway Source: DFLAT
    2. cell proliferation in forebrain Source: DFLAT
    3. cellular protein localization Source: MGI
    4. cerebral cortex radially oriented cell migration Source: DFLAT
    5. microtubule cytoskeleton organization Source: Ensembl
    6. mitochondrial calcium ion homeostasis Source: MGI
    7. neuron migration Source: UniProtKB
    8. positive regulation of neuroblast proliferation Source: UniProtKB
    9. positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: MGI
    10. positive regulation of Wnt signaling pathway Source: UniProtKB
    11. protein localization Source: MGI
    12. regulation of neuron projection development Source: UniProtKB
    13. regulation of synapse maturation Source: UniProtKB
    14. TOR signaling Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Neurogenesis, Wnt signaling pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disrupted in schizophrenia 1 homolog
    Gene namesi
    Name:Disc1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 8

    Organism-specific databases

    MGIiMGI:2447658. Disc1.

    Subcellular locationi

    Cytoplasm. Cytoplasmcytoskeleton. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density
    Note: Colocalizes with PCNT at the centrosome. Colocalizes with NDEL1 in the perinuclear region and the centrosome By similarity. Localizes to punctate cytoplasmic foci which overlap in part with mitochondria.By similarity

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. centrosome Source: MGI
    3. ciliary basal body Source: MGI
    4. microtubule Source: UniProtKB-KW
    5. mitochondrion Source: Ensembl
    6. postsynaptic density Source: UniProtKB-SubCell
    7. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Disruption phenotypei

    Loss of function of DISC1 in the dentate gyrus of adult mice results in reduced neural progenitor cell proliferation and the appearance of schizophrenic and depressive-like behaviors.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 852852Disrupted in schizophrenia 1 homologPRO_0000240230Add
    BLAST

    Proteomic databases

    PRIDEiQ811T9.

    PTM databases

    PhosphoSiteiQ811T9.

    Expressioni

    Tissue specificityi

    Expressed in granule cell precursors within the dentate migratory stream during the first week of postnatal life and in differentiated granule cells of the hippocampus (at protein level). Expressed in dentate gyrus, hippocampus and in the olfactory bulb.2 Publications

    Developmental stagei

    Expressed in neuronal progenitors residing in the ventricular and subventriculare zones and in postmitotic neurons in the cortical plate of the cerebral cortex at 15 dpc. Expressed in granule cell precursors within the dentate migratory stream of the hippocampus at 19 dpc (at protein level).2 Publications

    Gene expression databases

    BgeeiQ811T9.
    CleanExiMM_DISC1.
    GenevestigatoriQ811T9.

    Interactioni

    Subunit structurei

    Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1. Interacts (via C-terminal) with PCNT. Interacts with CHCHD6 By similarity. Interacts with NDEL1. Interacts with CCDC88A (via C-terminus); the interaction is direct. Interacts with GSK3B.By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    GSK3BP498414EBI-2298259,EBI-373586From a different organism.

    Protein-protein interaction databases

    BioGridi232675. 2 interactions.
    DIPiDIP-54914N.
    IntActiQ811T9. 5 interactions.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 294294Interaction with MAP1ABy similarityAdd
    BLAST
    Regioni295 – 693399Interaction with TRAF3IP1By similarityAdd
    BLAST
    Regioni437 – 594158Required for localization to punctate cytoplasmic fociBy similarityAdd
    BLAST
    Regioni443 – 852410Necessary and sufficient for interaction with PCNT and localization at the centrosomeBy similarityAdd
    BLAST
    Regioni595 – 852258Interaction with ATF4 and ATF5By similarityAdd
    BLAST
    Regioni728 – 852125Interaction with NDEL1 and PAFAH1B1By similarityAdd
    BLAST
    Regioni728 – 852125Interaction with PAFAH1B1By similarityAdd
    BLAST
    Regioni802 – 83534Interaction with NDEL1By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili367 – 39731Sequence AnalysisAdd
    BLAST
    Coiled coili449 – 49648Sequence AnalysisAdd
    BLAST

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG76097.
    GeneTreeiENSGT00390000006176.
    HOGENOMiHOG000056668.
    HOVERGENiHBG051360.
    KOiK16534.
    OMAiYMRSTAG.
    OrthoDBiEOG7WT40R.
    PhylomeDBiQ811T9.
    TreeFamiTF332357.

    Family and domain databases

    InterProiIPR026081. DISC1.
    [Graphical view]
    PANTHERiPTHR14332. PTHR14332. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q811T9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQGGGPRGAP IHSPSHGADS GHGLPPAVAP QRRRLTRRPG YMRSTAGSGI    50
    GFLSPAVGMP HPSSAGLTGQ QSQHSQSKAG QCGLDPGSHC QASLVGKPFL 100
    KSSLVPAVAS EGHLHPAQRS MRKRPVHFAV HSKNDSRQSE RLTGSFKPGD 150
    SGFWQELLSS DSFKSLAPSL DAPWNKGSRG LKTVKPLASP ALNGPADIAS 200
    LPGFQDTFTS SFSFIQLSLG AAGERGEAEG CLPSREAEPL HQRPQEMAAE 250
    ASSSDRPHGD PRHLWTFSLH AAPGLADLAQ VTRSSSRQSE CGTVSSSSSD 300
    TGFSSQDASS AGGRGDQGGG WADAHGWHTL LREWEPMLQD YLLSNRRQLE 350
    VTSLILKLQK CQEKVVEDGD YDTAETLRQR LEELEQEKGR LSWALPSQQP 400
    ALRSFLGYLA AQIQVALHGA TQRAGSDDPE APLEGQLRTT AQDSLPASIT 450
    RRDWLIREKQ RLQKEIEALQ ARMSALEAKE KRLSQELEEQ EVLLRWPGCD 500
    LMALVAQMSP GQLQEVSKAL GETLTSANQA PFQVEPPETL RSLRERTKSL 550
    NLAVRELTAQ VCSGEKLCSS LRRRLSDLDT RLPALLEAKM LALSGSCFST 600
    AKELTEEIWA LSSEREGLEM FLGRLLALSS RNSRRLGIVK EDHLRCRQDL 650
    ALQDAAHKTR MKANTVKCME VLEGQLSSCR CPLLGRVWKA DLETCQLLMQ 700
    SLQLQEAGSS PHAEDEEQVH STGEAAQTAA LAVPRTPHPE EEKSPLQVLQ 750
    EWDTHSALSP HCAAGPWKED SHIVSAEVGE KCEAIGVKLL HLEDQLLGAM 800
    YSHDEALFQS LQGELQTVKE TLQAMILQLQ PTKEAGEASA SYPTAGAQET 850
    EA 852
    Length:852
    Mass (Da):92,525
    Last modified:June 13, 2006 - v2
    Checksum:iB55A850B15028E6F
    GO
    Isoform 2 (identifier: Q811T9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-18: MQGGGPRGAPIHSPSHGA → MEAENSSWLTLPCLLY

    Note: No experimental confirmation available.

    Show »
    Length:850
    Mass (Da):92,681
    Checksum:i04E0133A67BC4B2E
    GO
    Isoform 3 (identifier: Q811T9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         595-658: GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHK → E

    Note: No experimental confirmation available.

    Show »
    Length:789
    Mass (Da):85,428
    Checksum:iC2EE115DF618732D
    GO
    Isoform 4 (identifier: Q811T9-4) [UniParc]FASTAAdd to Basket

    Also known as: ES

    The sequence of this isoform differs from the canonical sequence as follows:
         374-387: AETLRQRLEELEQE → GESKAVRRQFHLSP
         388-852: Missing.

    Show »
    Length:387
    Mass (Da):41,115
    Checksum:i066544374E3C8790
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti8 – 81G → D in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti8 – 81G → D in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti120 – 1201S → F in AAO19641. (PubMed:12506198)Curated
    Sequence conflicti120 – 1201S → F in AAP83943. (PubMed:12506198)Curated
    Sequence conflicti129 – 1291A → G in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti129 – 1291A → G in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti141 – 1411R → K in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti141 – 1411R → K in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti153 – 1531F → C in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti153 – 1531F → C in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti176 – 1761K → T in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti176 – 1761K → T in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti190 – 1901P → S in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti190 – 1901P → S in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti199 – 1991A → P in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti199 – 1991A → P in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti289 – 2891S → P in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti289 – 2891S → P in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti295 – 2951Missing in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti295 – 2951Missing in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti302 – 3021G → V in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti302 – 3021G → V in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti365 – 3651V → A in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti365 – 3651V → A in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti390 – 3901R → H in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti390 – 3901R → H in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti441 – 4411A → T in CAD44629. (PubMed:12573262)Curated
    Sequence conflicti461 – 4611R → Q in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti461 – 4611R → Q in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti474 – 4741S → Y in CAD44629. (PubMed:12573262)Curated
    Sequence conflicti533 – 5331Q → H in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti533 – 5331Q → H in AAN77092. (PubMed:12504857)Curated
    Sequence conflicti639 – 6391V → L in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti643 – 6431H → Y in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti788 – 7881K → R in AAN77091. (PubMed:12504857)Curated
    Sequence conflicti788 – 7881K → R in AAN77092. (PubMed:12504857)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1818MQGGG…PSHGA → MEAENSSWLTLPCLLY in isoform 2. 1 PublicationVSP_019318Add
    BLAST
    Alternative sequencei374 – 38714AETLR…ELEQE → GESKAVRRQFHLSP in isoform 4. 1 PublicationVSP_019319Add
    BLAST
    Alternative sequencei388 – 852465Missing in isoform 4. 1 PublicationVSP_019320Add
    BLAST
    Alternative sequencei595 – 65864GSCFS…DAAHK → E in isoform 3. 1 PublicationVSP_019321Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF513723 mRNA. Translation: AAN77091.1.
    AF513724 mRNA. Translation: AAN77092.1.
    AJ506179 mRNA. Translation: CAD44629.1.
    AJ506180 mRNA. Translation: CAD44630.1.
    AY177673 mRNA. Translation: AAO19641.1.
    AY320287 mRNA. Translation: AAP83943.1.
    CCDSiCCDS40517.1. [Q811T9-3]
    CCDS52707.1. [Q811T9-1]
    RefSeqiNP_777278.2. NM_174853.2. [Q811T9-3]
    NP_777279.2. NM_174854.2. [Q811T9-1]
    XP_006531084.1. XM_006531021.1. [Q811T9-1]
    XP_006531085.1. XM_006531022.1. [Q811T9-1]
    UniGeneiMm.233504.

    Genome annotation databases

    EnsembliENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051. [Q811T9-3]
    ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051. [Q811T9-1]
    ENSMUST00000117658; ENSMUSP00000112757; ENSMUSG00000043051. [Q811T9-3]
    ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051. [Q811T9-1]
    ENSMUST00000121953; ENSMUSP00000112929; ENSMUSG00000043051. [Q811T9-2]
    ENSMUST00000122389; ENSMUSP00000112593; ENSMUSG00000043051. [Q811T9-4]
    GeneIDi244667.
    KEGGimmu:244667.
    UCSCiuc009nyc.1. mouse. [Q811T9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF513723 mRNA. Translation: AAN77091.1 .
    AF513724 mRNA. Translation: AAN77092.1 .
    AJ506179 mRNA. Translation: CAD44629.1 .
    AJ506180 mRNA. Translation: CAD44630.1 .
    AY177673 mRNA. Translation: AAO19641.1 .
    AY320287 mRNA. Translation: AAP83943.1 .
    CCDSi CCDS40517.1. [Q811T9-3 ]
    CCDS52707.1. [Q811T9-1 ]
    RefSeqi NP_777278.2. NM_174853.2. [Q811T9-3 ]
    NP_777279.2. NM_174854.2. [Q811T9-1 ]
    XP_006531084.1. XM_006531021.1. [Q811T9-1 ]
    XP_006531085.1. XM_006531022.1. [Q811T9-1 ]
    UniGenei Mm.233504.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 232675. 2 interactions.
    DIPi DIP-54914N.
    IntActi Q811T9. 5 interactions.

    PTM databases

    PhosphoSitei Q811T9.

    Proteomic databases

    PRIDEi Q811T9.

    Protocols and materials databases

    DNASUi 244667.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000075730 ; ENSMUSP00000075145 ; ENSMUSG00000043051 . [Q811T9-3 ]
    ENSMUST00000098311 ; ENSMUSP00000095914 ; ENSMUSG00000043051 . [Q811T9-1 ]
    ENSMUST00000117658 ; ENSMUSP00000112757 ; ENSMUSG00000043051 . [Q811T9-3 ]
    ENSMUST00000118942 ; ENSMUSP00000112410 ; ENSMUSG00000043051 . [Q811T9-1 ]
    ENSMUST00000121953 ; ENSMUSP00000112929 ; ENSMUSG00000043051 . [Q811T9-2 ]
    ENSMUST00000122389 ; ENSMUSP00000112593 ; ENSMUSG00000043051 . [Q811T9-4 ]
    GeneIDi 244667.
    KEGGi mmu:244667.
    UCSCi uc009nyc.1. mouse. [Q811T9-1 ]

    Organism-specific databases

    CTDi 27185.
    MGIi MGI:2447658. Disc1.

    Phylogenomic databases

    eggNOGi NOG76097.
    GeneTreei ENSGT00390000006176.
    HOGENOMi HOG000056668.
    HOVERGENi HBG051360.
    KOi K16534.
    OMAi YMRSTAG.
    OrthoDBi EOG7WT40R.
    PhylomeDBi Q811T9.
    TreeFami TF332357.

    Miscellaneous databases

    NextBioi 386371.
    PROi Q811T9.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q811T9.
    CleanExi MM_DISC1.
    Genevestigatori Q811T9.

    Family and domain databases

    InterProi IPR026081. DISC1.
    [Graphical view ]
    PANTHERi PTHR14332. PTHR14332. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of Disc1, the mouse ortholog of DISC1 (Disrupted-in-Schizophrenia 1)."
      Ma L., Liu Y., Ky B., Shughrue P.J., Austin C.P., Morris J.A.
      Genomics 80:662-672(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
      Strain: BALB/c.
    2. "Evolutionary constraints on the Disrupted in Schizophrenia locus."
      Taylor M.S., Devon R.S., Millar J.K., Porteous D.J.
      Genomics 81:67-77(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1-594 (ISOFORM 1).
      Strain: C57BL/6.
    3. "Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth."
      Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A.
      Proc. Natl. Acad. Sci. U.S.A. 100:289-294(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
    4. Erratum
      Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A.
      Proc. Natl. Acad. Sci. U.S.A. 101:13969-13969(2004)
    5. "Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders."
      Brandon N.J., Handford E.J., Schurov I., Rain J.-C., Pelling M., Duran-Jimeniz B., Camargo L.M., Oliver K.R., Beher D., Shearman M.S., Whiting P.J.
      Mol. Cell. Neurosci. 25:42-55(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NDEL1, SUBCELLULAR LOCATION.
    6. "Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site."
      Brandon N.J., Schurov I., Camargo L.M., Handford E.J., Duran-Jimeniz B., Hunt P., Millar J.K., Porteous D.J., Shearman M.S., Whiting P.J.
      Mol. Cell. Neurosci. 28:613-624(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    7. "Disrupted-In-Schizophrenia 1 regulates integration of newly generated neurons in the adult brain."
      Duan X., Chang J.H., Ge S., Faulkner R.L., Kim J.Y., Kitabatake Y., Liu X.B., Yang C.H., Jordan J.D., Ma D.K., Liu C.Y., Ganesan S., Cheng H.J., Ming G.L., Lu B., Song H.
      Cell 130:1146-1158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    8. "Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling."
      Mao Y., Ge X., Frank C.L., Madison J.M., Koehler A.N., Doud M.K., Tassa C., Berry E.M., Soda T., Singh K.K., Biechele T., Petryshen T.L., Moon R.T., Haggarty S.J., Tsai L.H.
      Cell 136:1017-1031(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH GSK3B, DEVELOPMENTAL STAGE.
    9. "Disc1 regulates granule cell migration in the developing hippocampus."
      Meyer K.D., Morris J.A.
      Hum. Mol. Genet. 18:3286-3297(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    10. "DISC1 regulates new neuron development in the adult brain via modulation of AKT-mTOR signaling through KIAA1212."
      Kim J.Y., Duan X., Liu C.Y., Jang M.H., Guo J.U., Pow-anpongkul N., Kang E., Song H., Ming G.L.
      Neuron 63:761-773(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CCDC88A.
    11. "Deletion of densin-180 results in abnormal behaviors associated with mental illness and reduces mGluR5 and DISC1 in the postsynaptic density fraction."
      Carlisle H.J., Luong T.N., Medina-Marino A., Schenker L., Khorosheva E., Indersmitten T., Gunapala K.M., Steele A.D., O'Dell T.J., Patterson P.H., Kennedy M.B.
      J. Neurosci. 31:16194-16207(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiDISC1_MOUSE
    AccessioniPrimary (citable) accession number: Q811T9
    Secondary accession number(s): Q7TQ21
    , Q8CF87, Q8CF88, Q8CHP1, Q8CHP2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 13, 2006
    Last sequence update: June 13, 2006
    Last modified: October 1, 2014
    This is version 82 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3