Reviewed,
UniProtKB/Swiss-Prot Q811T9 (DISC1_MOUSE)
Last modified
February 9, 2010.
Version 45.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disrupted in schizophrenia 1 homolog | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 852 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subunit structure | Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1 By similarity. Interacts with NDEL1. Ref.5 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton › centrosome. Cytoplasm › cytoskeleton. Note: Localizes to neurites By similarity. Localizes to punctate cytoplasmic foci which overlap in part with mitochondria. Also localizes to the centrosome. Ref.5 Ref.6 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Gene Ontology (GO) | |
| Cellular component | microtubule Inferred from electronic annotation. Source: UniProtKB-KW microtubule organizing centerInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein binding Inferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GSK3B | P49841 | 3 | EBI-2298259,EBI-373586 | From a different organism. |
| Gsk3b | Q9WV60 | 1 | EBI-2298259,EBI-400793 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q811T9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q811T9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQGGGPRGAPIHSPSHGA → MEAENSSWLTLPCLLY | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q811T9-3) The sequence of this isoform differs from the canonical sequence as follows: 595-658: GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHK → E | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q811T9-4) Also known as: ES; The sequence of this isoform differs from the canonical sequence as follows: 374-387: AETLRQRLEELEQE → GESKAVRRQFHLSP 388-852: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 852 | 852 | Disrupted in schizophrenia 1 homolog | PRO_0000240230 | |||||
Regions | |||||||||
| Region | 1 – 294 | 294 | Interaction with MAP1A By similarity | ||||||
| Region | 295 – 693 | 399 | Interaction with TRAF3IP1 By similarity | ||||||
| Region | 437 – 594 | 158 | Required for localization to punctate cytoplasmic foci By similarity | ||||||
| Region | 595 – 852 | 258 | Interaction with ATF4 and ATF5 By similarity | ||||||
| Region | 728 – 852 | 125 | Interaction with NDEL1 and PAFAH1B1 By similarity | ||||||
| Coiled coil | 367 – 397 | 31 | Potential | ||||||
| Coiled coil | 449 – 496 | 48 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 18 | 18 | MQGGG…PSHGA → MEAENSSWLTLPCLLY in isoform 2. | VSP_019318 | |||||
| Alternative sequence | 374 – 387 | 14 | AETLR…ELEQE → GESKAVRRQFHLSP in isoform 4. | VSP_019319 | |||||
| Alternative sequence | 388 – 852 | 465 | Missing in isoform 4. | VSP_019320 | |||||
| Alternative sequence | 595 – 658 | 64 | GSCFS…DAAHK → E in isoform 3. | VSP_019321 | |||||
Experimental info | |||||||||
| Sequence conflict | 8 | 1 | G → D in AAN77091. Ref.1 | ||||||
| Sequence conflict | 8 | 1 | G → D in AAN77092. Ref.1 | ||||||
| Sequence conflict | 120 | 1 | S → F in AAO19641. Ref.3 | ||||||
| Sequence conflict | 120 | 1 | S → F in AAP83943. Ref.3 | ||||||
| Sequence conflict | 129 | 1 | A → G in AAN77091. Ref.1 | ||||||
| Sequence conflict | 129 | 1 | A → G in AAN77092. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | R → K in AAN77091. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | R → K in AAN77092. Ref.1 | ||||||
| Sequence conflict | 153 | 1 | F → C in AAN77091. Ref.1 | ||||||
| Sequence conflict | 153 | 1 | F → C in AAN77092. Ref.1 | ||||||
| Sequence conflict | 176 | 1 | K → T in AAN77091. Ref.1 | ||||||
| Sequence conflict | 176 | 1 | K → T in AAN77092. Ref.1 | ||||||
| Sequence conflict | 190 | 1 | P → S in AAN77091. Ref.1 | ||||||
| Sequence conflict | 190 | 1 | P → S in AAN77092. Ref.1 | ||||||
| Sequence conflict | 199 | 1 | A → P in AAN77091. Ref.1 | ||||||
| Sequence conflict | 199 | 1 | A → P in AAN77092. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | S → P in AAN77091. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | S → P in AAN77092. Ref.1 | ||||||
| Sequence conflict | 295 | 1 | Missing in AAN77091. Ref.1 | ||||||
| Sequence conflict | 295 | 1 | Missing in AAN77092. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | G → V in AAN77091. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | G → V in AAN77092. Ref.1 | ||||||
| Sequence conflict | 365 | 1 | V → A in AAN77091. Ref.1 | ||||||
| Sequence conflict | 365 | 1 | V → A in AAN77092. Ref.1 | ||||||
| Sequence conflict | 390 | 1 | R → H in AAN77091. Ref.1 | ||||||
| Sequence conflict | 390 | 1 | R → H in AAN77092. Ref.1 | ||||||
| Sequence conflict | 441 | 1 | A → T in CAD44629. Ref.2 | ||||||
| Sequence conflict | 461 | 1 | R → Q in AAN77091. Ref.1 | ||||||
| Sequence conflict | 461 | 1 | R → Q in AAN77092. Ref.1 | ||||||
| Sequence conflict | 474 | 1 | S → Y in CAD44629. Ref.2 | ||||||
| Sequence conflict | 533 | 1 | Q → H in AAN77091. Ref.1 | ||||||
| Sequence conflict | 533 | 1 | Q → H in AAN77092. Ref.1 | ||||||
| Sequence conflict | 639 | 1 | V → L in AAN77091. Ref.1 | ||||||
| Sequence conflict | 643 | 1 | H → Y in AAN77091. Ref.1 | ||||||
| Sequence conflict | 788 | 1 | K → R in AAN77091. Ref.1 | ||||||
| Sequence conflict | 788 | 1 | K → R in AAN77092. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Cloning and characterization of Disc1, the mouse ortholog of DISC1 (Disrupted-in-Schizophrenia 1)." Ma L., Liu Y., Ky B., Shughrue P.J., Austin C.P., Morris J.A. Genomics 80:662-672(2002) [PubMed: 12504857] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). Strain: BALB/c. |
| [2] | "Evolutionary constraints on the Disrupted in Schizophrenia locus." Taylor M.S., Devon R.S., Millar J.K., Porteous D.J. Genomics 81:67-77(2003) [PubMed: 12573262] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1-594 (ISOFORM 1). Strain: C57BL/6. |
| [3] | "Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth." Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 100:289-294(2003) [PubMed: 12506198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. |
| [4] | Erratum Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 101:13969-13969(2004) |
| [5] | "Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders." Brandon N.J., Handford E.J., Schurov I., Rain J.-C., Pelling M., Duran-Jimeniz B., Camargo L.M., Oliver K.R., Beher D., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 25:42-55(2004) [PubMed: 14962739] [Abstract] Cited for: INTERACTION WITH NDEL1, SUBCELLULAR LOCATION. |
| [6] | "Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site." Brandon N.J., Schurov I., Camargo L.M., Handford E.J., Duran-Jimeniz B., Hunt P., Millar J.K., Porteous D.J., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 28:613-624(2005) [PubMed: 15797709] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF513723 mRNA. Translation: AAN77091.1. AF513724 mRNA. Translation: AAN77092.1. AJ506179 mRNA. Translation: CAD44629.1. AJ506180 mRNA. Translation: CAD44630.1. AY177673 mRNA. Translation: AAO19641.1. AY320287 mRNA. Translation: AAP83943.1. |
| IPI | IPI00229246. IPI00399803. IPI00752934. IPI00760027. |
| RefSeq | NP_777278.2. NP_777279.2. |
| UniGene | Mm.233504 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q811T9. 4 interactions. |
| STRING | Q811T9. |
Proteomic databases | |
| PRIDE | Q811T9. |
Genome annotation databases | |
| Ensembl | ENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051; Mus musculus. [Genome view] ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051; Mus musculus. [Genome view] ENSMUST00000115885; ENSMUSP00000111552; ENSMUSG00000079751; Mus musculus. [Genome view] ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051; Mus musculus. [Genome view] |
| GeneID | 244667. |
| KEGG | mmu:244667. |
| UCSC | uc009nyb.1. mouse. uc009nyc.1. mouse. uc009nyd.1. mouse. |
Organism-specific databases | |
| CTD | 244667. |
| MGI | MGI:2447658. Disc1. |
Phylogenomic databases | |
| eggNOG | roNOG04243. |
| HOVERGEN | Q811T9. |
Gene expression databases | |
| Bgee | Q811T9. |
| CleanEx | MM_DISC1. |
| Genevestigator | Q811T9. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 386371. |
| SOURCE | Search... |
Entry information
| Entry name | DISC1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q811T9 Secondary accession number(s): Q7TQ21 Q8CHP2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |

Clusters with


