Q811T9 (DISC1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disrupted in schizophrenia 1 homolog | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 852 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation. Ref.7 Ref.8 Ref.9 Ref.10 |
| Subunit structure | Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1. Interacts (via C-terminal) with PCNT. Interacts with CHCHD6 By similarity. Interacts with NDEL1. Interacts with CCDC88A (via C-terminus); the interaction is direct. Interacts with GSK3B. Ref.5 Ref.8 Ref.10 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › centrosome. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density. Note: Colocalizes with PCNT at the centrosome. Colocalizes with NDEL1 in the perinuclear region and the centrosome By similarity. Localizes to punctate cytoplasmic foci which overlap in part with mitochondria. Ref.5 Ref.6 Ref.11 |
| Tissue specificity | Expressed in granule cell precursors within the dentate migratory stream during the first week of postnatal life and in differentiated granule cells of the hippocampus (at protein level). Expressed in dentate gyrus, hippocampus and in the olfactory bulb. Ref.7 Ref.9 |
| Developmental stage | Expressed in neuronal progenitors residing in the ventricular and subventriculare zones and in postmitotic neurons in the cortical plate of the cerebral cortex at 15 dpc. Expressed in granule cell precursors within the dentate migratory stream of the hippocampus at 19 dpc (at protein level). Ref.8 Ref.9 |
| Disruption phenotype | Loss of function of DISC1 in the dentate gyrus of adult mice results in reduced neural progenitor cell proliferation and the appearance of schizophrenic and depressive-like behaviors. Ref.9 |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GSK3B | P49841 | 4 | EBI-2298259,EBI-373586 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q811T9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q811T9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-18: MQGGGPRGAPIHSPSHGA → MEAENSSWLTLPCLLY | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q811T9-3) The sequence of this isoform differs from the canonical sequence as follows: 595-658: GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHK → E | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q811T9-4) Also known as: ES; The sequence of this isoform differs from the canonical sequence as follows: 374-387: AETLRQRLEELEQE → GESKAVRRQFHLSP 388-852: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 852 | 852 | Disrupted in schizophrenia 1 homolog | PRO_0000240230 | |||||
Regions | |||||||||
| Region | 1 – 294 | 294 | Interaction with MAP1A By similarity | ||||||
| Region | 295 – 693 | 399 | Interaction with TRAF3IP1 By similarity | ||||||
| Region | 437 – 594 | 158 | Required for localization to punctate cytoplasmic foci By similarity | ||||||
| Region | 443 – 852 | 410 | Necessary and sufficient for interaction with PCNT and localization at the centrosome By similarity | ||||||
| Region | 595 – 852 | 258 | Interaction with ATF4 and ATF5 By similarity | ||||||
| Region | 728 – 852 | 125 | Interaction with NDEL1 and PAFAH1B1 By similarity | ||||||
| Region | 728 – 852 | 125 | Interaction with PAFAH1B1 By similarity | ||||||
| Region | 802 – 835 | 34 | Interaction with NDEL1 By similarity | ||||||
| Coiled coil | 367 – 397 | 31 | Potential | ||||||
| Coiled coil | 449 – 496 | 48 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 18 | 18 | MQGGG…PSHGA → MEAENSSWLTLPCLLY in isoform 2. | VSP_019318 | |||||
| Alternative sequence | 374 – 387 | 14 | AETLR…ELEQE → GESKAVRRQFHLSP in isoform 4. | VSP_019319 | |||||
| Alternative sequence | 388 – 852 | 465 | Missing in isoform 4. | VSP_019320 | |||||
| Alternative sequence | 595 – 658 | 64 | GSCFS…DAAHK → E in isoform 3. | VSP_019321 | |||||
Experimental info | |||||||||
| Sequence conflict | 8 | 1 | G → D in AAN77091. Ref.1 | ||||||
| Sequence conflict | 8 | 1 | G → D in AAN77092. Ref.1 | ||||||
| Sequence conflict | 120 | 1 | S → F in AAO19641. Ref.3 | ||||||
| Sequence conflict | 120 | 1 | S → F in AAP83943. Ref.3 | ||||||
| Sequence conflict | 129 | 1 | A → G in AAN77091. Ref.1 | ||||||
| Sequence conflict | 129 | 1 | A → G in AAN77092. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | R → K in AAN77091. Ref.1 | ||||||
| Sequence conflict | 141 | 1 | R → K in AAN77092. Ref.1 | ||||||
| Sequence conflict | 153 | 1 | F → C in AAN77091. Ref.1 | ||||||
| Sequence conflict | 153 | 1 | F → C in AAN77092. Ref.1 | ||||||
| Sequence conflict | 176 | 1 | K → T in AAN77091. Ref.1 | ||||||
| Sequence conflict | 176 | 1 | K → T in AAN77092. Ref.1 | ||||||
| Sequence conflict | 190 | 1 | P → S in AAN77091. Ref.1 | ||||||
| Sequence conflict | 190 | 1 | P → S in AAN77092. Ref.1 | ||||||
| Sequence conflict | 199 | 1 | A → P in AAN77091. Ref.1 | ||||||
| Sequence conflict | 199 | 1 | A → P in AAN77092. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | S → P in AAN77091. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | S → P in AAN77092. Ref.1 | ||||||
| Sequence conflict | 295 | 1 | Missing in AAN77091. Ref.1 | ||||||
| Sequence conflict | 295 | 1 | Missing in AAN77092. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | G → V in AAN77091. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | G → V in AAN77092. Ref.1 | ||||||
| Sequence conflict | 365 | 1 | V → A in AAN77091. Ref.1 | ||||||
| Sequence conflict | 365 | 1 | V → A in AAN77092. Ref.1 | ||||||
| Sequence conflict | 390 | 1 | R → H in AAN77091. Ref.1 | ||||||
| Sequence conflict | 390 | 1 | R → H in AAN77092. Ref.1 | ||||||
| Sequence conflict | 441 | 1 | A → T in CAD44629. Ref.2 | ||||||
| Sequence conflict | 461 | 1 | R → Q in AAN77091. Ref.1 | ||||||
| Sequence conflict | 461 | 1 | R → Q in AAN77092. Ref.1 | ||||||
| Sequence conflict | 474 | 1 | S → Y in CAD44629. Ref.2 | ||||||
| Sequence conflict | 533 | 1 | Q → H in AAN77091. Ref.1 | ||||||
| Sequence conflict | 533 | 1 | Q → H in AAN77092. Ref.1 | ||||||
| Sequence conflict | 639 | 1 | V → L in AAN77091. Ref.1 | ||||||
| Sequence conflict | 643 | 1 | H → Y in AAN77091. Ref.1 | ||||||
| Sequence conflict | 788 | 1 | K → R in AAN77091. Ref.1 | ||||||
| Sequence conflict | 788 | 1 | K → R in AAN77092. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Cloning and characterization of Disc1, the mouse ortholog of DISC1 (Disrupted-in-Schizophrenia 1)." Ma L., Liu Y., Ky B., Shughrue P.J., Austin C.P., Morris J.A. Genomics 80:662-672(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). Strain: BALB/c. |
| [2] | "Evolutionary constraints on the Disrupted in Schizophrenia locus." Taylor M.S., Devon R.S., Millar J.K., Porteous D.J. Genomics 81:67-77(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1-594 (ISOFORM 1). Strain: C57BL/6. |
| [3] | "Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth." Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 100:289-294(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. |
| [4] | Erratum Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A. Proc. Natl. Acad. Sci. U.S.A. 101:13969-13969(2004) |
| [5] | "Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders." Brandon N.J., Handford E.J., Schurov I., Rain J.-C., Pelling M., Duran-Jimeniz B., Camargo L.M., Oliver K.R., Beher D., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 25:42-55(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NDEL1, SUBCELLULAR LOCATION. |
| [6] | "Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site." Brandon N.J., Schurov I., Camargo L.M., Handford E.J., Duran-Jimeniz B., Hunt P., Millar J.K., Porteous D.J., Shearman M.S., Whiting P.J. Mol. Cell. Neurosci. 28:613-624(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [7] | "Disrupted-In-Schizophrenia 1 regulates integration of newly generated neurons in the adult brain." Duan X., Chang J.H., Ge S., Faulkner R.L., Kim J.Y., Kitabatake Y., Liu X.B., Yang C.H., Jordan J.D., Ma D.K., Liu C.Y., Ganesan S., Cheng H.J., Ming G.L., Lu B., Song H. Cell 130:1146-1158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [8] | "Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling." Mao Y., Ge X., Frank C.L., Madison J.M., Koehler A.N., Doud M.K., Tassa C., Berry E.M., Soda T., Singh K.K., Biechele T., Petryshen T.L., Moon R.T., Haggarty S.J., Tsai L.H. Cell 136:1017-1031(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH GSK3B, DEVELOPMENTAL STAGE. |
| [9] | "Disc1 regulates granule cell migration in the developing hippocampus." Meyer K.D., Morris J.A. Hum. Mol. Genet. 18:3286-3297(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [10] | "DISC1 regulates new neuron development in the adult brain via modulation of AKT-mTOR signaling through KIAA1212." Kim J.Y., Duan X., Liu C.Y., Jang M.H., Guo J.U., Pow-anpongkul N., Kang E., Song H., Ming G.L. Neuron 63:761-773(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CCDC88A. |
| [11] | "Deletion of densin-180 results in abnormal behaviors associated with mental illness and reduces mGluR5 and DISC1 in the postsynaptic density fraction." Carlisle H.J., Luong T.N., Medina-Marino A., Schenker L., Khorosheva E., Indersmitten T., Gunapala K.M., Steele A.D., O'Dell T.J., Patterson P.H., Kennedy M.B. J. Neurosci. 31:16194-16207(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF513723 mRNA. Translation: AAN77091.1. AF513724 mRNA. Translation: AAN77092.1. AJ506179 mRNA. Translation: CAD44629.1. AJ506180 mRNA. Translation: CAD44630.1. AY177673 mRNA. Translation: AAO19641.1. AY320287 mRNA. Translation: AAP83943.1. |
| IPI | IPI00229246. IPI00399803. IPI00752934. IPI00760027. |
| RefSeq | NP_777278.2. NM_174853.2. NP_777279.2. NM_174854.2. |
| UniGene | Mm.233504. |
3D structure databases | |
| ProteinModelPortal | Q811T9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-54914N. |
| IntAct | Q811T9. 5 interactions. |
PTM databases | |
| PhosphoSite | Q811T9. |
Proteomic databases | |
| PRIDE | Q811T9. |
Protocols and materials databases | |
| DNASU | 244667. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051. ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051. ENSMUST00000117658; ENSMUSP00000112757; ENSMUSG00000043051. ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051. ENSMUST00000121953; ENSMUSP00000112929; ENSMUSG00000043051. ENSMUST00000122389; ENSMUSP00000112593; ENSMUSG00000043051. |
| GeneID | 244667. |
| KEGG | mmu:244667. |
Organism-specific databases | |
| CTD | 27185. |
| MGI | MGI:2447658. Disc1. |
Phylogenomic databases | |
| eggNOG | NOG76097. |
| GeneTree | ENSGT00390000006176. |
| HOGENOM | HOG000056668. |
| HOVERGEN | HBG051360. |
| KO | K16534. |
| OMA | EKCEDIG. |
| OrthoDB | EOG4DNF3X. |
Gene expression databases | |
| ArrayExpress | Q811T9. |
| Bgee | Q811T9. |
| CleanEx | MM_DISC1. |
| Genevestigator | Q811T9. |
Family and domain databases | |
| InterPro | IPR026081. DISC1. [Graphical view] |
| PANTHER | PTHR14332. PTHR14332. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 386371. |
| SOURCE | Search... |
Entry information
| Entry name | DISC1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q811T9 Secondary accession number(s): Q7TQ21 Q8CHP2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |

Clusters with
