Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q811T9

- DISC1_MOUSE

UniProt

Q811T9 - DISC1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disrupted in schizophrenia 1 homolog

Gene

Disc1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation.4 Publications

GO - Biological processi

  1. canonical Wnt signaling pathway Source: DFLAT
  2. cell proliferation in forebrain Source: DFLAT
  3. cellular protein localization Source: MGI
  4. cerebral cortex radially oriented cell migration Source: DFLAT
  5. microtubule cytoskeleton organization Source: Ensembl
  6. mitochondrial calcium ion homeostasis Source: MGI
  7. neuron migration Source: UniProtKB
  8. positive regulation of neuroblast proliferation Source: UniProtKB
  9. positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: MGI
  10. positive regulation of Wnt signaling pathway Source: UniProtKB
  11. protein localization Source: MGI
  12. regulation of neuron projection development Source: UniProtKB
  13. regulation of synapse maturation Source: UniProtKB
  14. TOR signaling Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Neurogenesis, Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Disrupted in schizophrenia 1 homolog
Gene namesi
Name:Disc1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:2447658. Disc1.

Subcellular locationi

Cytoplasm. Cytoplasmcytoskeleton. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density
Note: Colocalizes with PCNT at the centrosome. Colocalizes with NDEL1 in the perinuclear region and the centrosome By similarity. Localizes to punctate cytoplasmic foci which overlap in part with mitochondria.By similarity

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. centrosome Source: MGI
  3. ciliary basal body Source: MGI
  4. microtubule Source: UniProtKB-KW
  5. mitochondrion Source: Ensembl
  6. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Loss of function of DISC1 in the dentate gyrus of adult mice results in reduced neural progenitor cell proliferation and the appearance of schizophrenic and depressive-like behaviors.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 852852Disrupted in schizophrenia 1 homologPRO_0000240230Add
BLAST

Proteomic databases

PRIDEiQ811T9.

PTM databases

PhosphoSiteiQ811T9.

Expressioni

Tissue specificityi

Expressed in granule cell precursors within the dentate migratory stream during the first week of postnatal life and in differentiated granule cells of the hippocampus (at protein level). Expressed in dentate gyrus, hippocampus and in the olfactory bulb.2 Publications

Developmental stagei

Expressed in neuronal progenitors residing in the ventricular and subventriculare zones and in postmitotic neurons in the cortical plate of the cerebral cortex at 15 dpc. Expressed in granule cell precursors within the dentate migratory stream of the hippocampus at 19 dpc (at protein level).2 Publications

Gene expression databases

BgeeiQ811T9.
CleanExiMM_DISC1.
ExpressionAtlasiQ811T9. baseline.
GenevestigatoriQ811T9.

Interactioni

Subunit structurei

Interacts with tubulin alpha, ACTN2, ANKHD1, ATF4, ATF5, CEP63, EIF3S3, MAP1A, PAFAH1B1, RANBP9, SPTBN4, SYNE1 and TRAF3IP1. Interaction with microtubules may be mediated in part by TRAF3IP1. Interacts (via C-terminal) with PCNT. Interacts with CHCHD6 By similarity. Interacts with NDEL1. Interacts with CCDC88A (via C-terminus); the interaction is direct. Interacts with GSK3B.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
GSK3BP498414EBI-2298259,EBI-373586From a different organism.

Protein-protein interaction databases

BioGridi232675. 2 interactions.
DIPiDIP-54914N.
IntActiQ811T9. 5 interactions.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 294294Interaction with MAP1ABy similarityAdd
BLAST
Regioni295 – 693399Interaction with TRAF3IP1By similarityAdd
BLAST
Regioni437 – 594158Required for localization to punctate cytoplasmic fociBy similarityAdd
BLAST
Regioni443 – 852410Necessary and sufficient for interaction with PCNT and localization at the centrosomeBy similarityAdd
BLAST
Regioni595 – 852258Interaction with ATF4 and ATF5By similarityAdd
BLAST
Regioni728 – 852125Interaction with NDEL1 and PAFAH1B1By similarityAdd
BLAST
Regioni728 – 852125Interaction with PAFAH1B1By similarityAdd
BLAST
Regioni802 – 83534Interaction with NDEL1By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili367 – 39731Sequence AnalysisAdd
BLAST
Coiled coili449 – 49648Sequence AnalysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG76097.
GeneTreeiENSGT00390000006176.
HOGENOMiHOG000056668.
HOVERGENiHBG051360.
InParanoidiQ811T9.
KOiK16534.
OMAiYMRSTAG.
OrthoDBiEOG7WT40R.
PhylomeDBiQ811T9.
TreeFamiTF332357.

Family and domain databases

InterProiIPR026081. DISC1.
[Graphical view]
PANTHERiPTHR14332. PTHR14332. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q811T9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQGGGPRGAP IHSPSHGADS GHGLPPAVAP QRRRLTRRPG YMRSTAGSGI
60 70 80 90 100
GFLSPAVGMP HPSSAGLTGQ QSQHSQSKAG QCGLDPGSHC QASLVGKPFL
110 120 130 140 150
KSSLVPAVAS EGHLHPAQRS MRKRPVHFAV HSKNDSRQSE RLTGSFKPGD
160 170 180 190 200
SGFWQELLSS DSFKSLAPSL DAPWNKGSRG LKTVKPLASP ALNGPADIAS
210 220 230 240 250
LPGFQDTFTS SFSFIQLSLG AAGERGEAEG CLPSREAEPL HQRPQEMAAE
260 270 280 290 300
ASSSDRPHGD PRHLWTFSLH AAPGLADLAQ VTRSSSRQSE CGTVSSSSSD
310 320 330 340 350
TGFSSQDASS AGGRGDQGGG WADAHGWHTL LREWEPMLQD YLLSNRRQLE
360 370 380 390 400
VTSLILKLQK CQEKVVEDGD YDTAETLRQR LEELEQEKGR LSWALPSQQP
410 420 430 440 450
ALRSFLGYLA AQIQVALHGA TQRAGSDDPE APLEGQLRTT AQDSLPASIT
460 470 480 490 500
RRDWLIREKQ RLQKEIEALQ ARMSALEAKE KRLSQELEEQ EVLLRWPGCD
510 520 530 540 550
LMALVAQMSP GQLQEVSKAL GETLTSANQA PFQVEPPETL RSLRERTKSL
560 570 580 590 600
NLAVRELTAQ VCSGEKLCSS LRRRLSDLDT RLPALLEAKM LALSGSCFST
610 620 630 640 650
AKELTEEIWA LSSEREGLEM FLGRLLALSS RNSRRLGIVK EDHLRCRQDL
660 670 680 690 700
ALQDAAHKTR MKANTVKCME VLEGQLSSCR CPLLGRVWKA DLETCQLLMQ
710 720 730 740 750
SLQLQEAGSS PHAEDEEQVH STGEAAQTAA LAVPRTPHPE EEKSPLQVLQ
760 770 780 790 800
EWDTHSALSP HCAAGPWKED SHIVSAEVGE KCEAIGVKLL HLEDQLLGAM
810 820 830 840 850
YSHDEALFQS LQGELQTVKE TLQAMILQLQ PTKEAGEASA SYPTAGAQET

EA
Length:852
Mass (Da):92,525
Last modified:June 13, 2006 - v2
Checksum:iB55A850B15028E6F
GO
Isoform 2 (identifier: Q811T9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQGGGPRGAPIHSPSHGA → MEAENSSWLTLPCLLY

Note: No experimental confirmation available.

Show »
Length:850
Mass (Da):92,681
Checksum:i04E0133A67BC4B2E
GO
Isoform 3 (identifier: Q811T9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     595-658: GSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHK → E

Note: No experimental confirmation available.

Show »
Length:789
Mass (Da):85,428
Checksum:iC2EE115DF618732D
GO
Isoform 4 (identifier: Q811T9-4) [UniParc]FASTAAdd to Basket

Also known as: ES

The sequence of this isoform differs from the canonical sequence as follows:
     374-387: AETLRQRLEELEQE → GESKAVRRQFHLSP
     388-852: Missing.

Show »
Length:387
Mass (Da):41,115
Checksum:i066544374E3C8790
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81G → D in AAN77091. (PubMed:12504857)Curated
Sequence conflicti8 – 81G → D in AAN77092. (PubMed:12504857)Curated
Sequence conflicti120 – 1201S → F in AAO19641. (PubMed:12506198)Curated
Sequence conflicti120 – 1201S → F in AAP83943. (PubMed:12506198)Curated
Sequence conflicti129 – 1291A → G in AAN77091. (PubMed:12504857)Curated
Sequence conflicti129 – 1291A → G in AAN77092. (PubMed:12504857)Curated
Sequence conflicti141 – 1411R → K in AAN77091. (PubMed:12504857)Curated
Sequence conflicti141 – 1411R → K in AAN77092. (PubMed:12504857)Curated
Sequence conflicti153 – 1531F → C in AAN77091. (PubMed:12504857)Curated
Sequence conflicti153 – 1531F → C in AAN77092. (PubMed:12504857)Curated
Sequence conflicti176 – 1761K → T in AAN77091. (PubMed:12504857)Curated
Sequence conflicti176 – 1761K → T in AAN77092. (PubMed:12504857)Curated
Sequence conflicti190 – 1901P → S in AAN77091. (PubMed:12504857)Curated
Sequence conflicti190 – 1901P → S in AAN77092. (PubMed:12504857)Curated
Sequence conflicti199 – 1991A → P in AAN77091. (PubMed:12504857)Curated
Sequence conflicti199 – 1991A → P in AAN77092. (PubMed:12504857)Curated
Sequence conflicti289 – 2891S → P in AAN77091. (PubMed:12504857)Curated
Sequence conflicti289 – 2891S → P in AAN77092. (PubMed:12504857)Curated
Sequence conflicti295 – 2951Missing in AAN77091. (PubMed:12504857)Curated
Sequence conflicti295 – 2951Missing in AAN77092. (PubMed:12504857)Curated
Sequence conflicti302 – 3021G → V in AAN77091. (PubMed:12504857)Curated
Sequence conflicti302 – 3021G → V in AAN77092. (PubMed:12504857)Curated
Sequence conflicti365 – 3651V → A in AAN77091. (PubMed:12504857)Curated
Sequence conflicti365 – 3651V → A in AAN77092. (PubMed:12504857)Curated
Sequence conflicti390 – 3901R → H in AAN77091. (PubMed:12504857)Curated
Sequence conflicti390 – 3901R → H in AAN77092. (PubMed:12504857)Curated
Sequence conflicti441 – 4411A → T in CAD44629. (PubMed:12573262)Curated
Sequence conflicti461 – 4611R → Q in AAN77091. (PubMed:12504857)Curated
Sequence conflicti461 – 4611R → Q in AAN77092. (PubMed:12504857)Curated
Sequence conflicti474 – 4741S → Y in CAD44629. (PubMed:12573262)Curated
Sequence conflicti533 – 5331Q → H in AAN77091. (PubMed:12504857)Curated
Sequence conflicti533 – 5331Q → H in AAN77092. (PubMed:12504857)Curated
Sequence conflicti639 – 6391V → L in AAN77091. (PubMed:12504857)Curated
Sequence conflicti643 – 6431H → Y in AAN77091. (PubMed:12504857)Curated
Sequence conflicti788 – 7881K → R in AAN77091. (PubMed:12504857)Curated
Sequence conflicti788 – 7881K → R in AAN77092. (PubMed:12504857)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818MQGGG…PSHGA → MEAENSSWLTLPCLLY in isoform 2. 1 PublicationVSP_019318Add
BLAST
Alternative sequencei374 – 38714AETLR…ELEQE → GESKAVRRQFHLSP in isoform 4. 1 PublicationVSP_019319Add
BLAST
Alternative sequencei388 – 852465Missing in isoform 4. 1 PublicationVSP_019320Add
BLAST
Alternative sequencei595 – 65864GSCFS…DAAHK → E in isoform 3. 1 PublicationVSP_019321Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF513723 mRNA. Translation: AAN77091.1.
AF513724 mRNA. Translation: AAN77092.1.
AJ506179 mRNA. Translation: CAD44629.1.
AJ506180 mRNA. Translation: CAD44630.1.
AY177673 mRNA. Translation: AAO19641.1.
AY320287 mRNA. Translation: AAP83943.1.
CCDSiCCDS40517.1. [Q811T9-3]
CCDS52707.1. [Q811T9-1]
RefSeqiNP_777278.2. NM_174853.2. [Q811T9-3]
NP_777279.2. NM_174854.2. [Q811T9-1]
XP_006531084.1. XM_006531021.1. [Q811T9-1]
XP_006531085.1. XM_006531022.1. [Q811T9-1]
UniGeneiMm.233504.

Genome annotation databases

EnsembliENSMUST00000075730; ENSMUSP00000075145; ENSMUSG00000043051. [Q811T9-3]
ENSMUST00000098311; ENSMUSP00000095914; ENSMUSG00000043051. [Q811T9-1]
ENSMUST00000117658; ENSMUSP00000112757; ENSMUSG00000043051. [Q811T9-3]
ENSMUST00000118942; ENSMUSP00000112410; ENSMUSG00000043051. [Q811T9-1]
ENSMUST00000121953; ENSMUSP00000112929; ENSMUSG00000043051. [Q811T9-2]
ENSMUST00000122389; ENSMUSP00000112593; ENSMUSG00000043051. [Q811T9-4]
GeneIDi244667.
KEGGimmu:244667.
UCSCiuc009nyc.1. mouse. [Q811T9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF513723 mRNA. Translation: AAN77091.1 .
AF513724 mRNA. Translation: AAN77092.1 .
AJ506179 mRNA. Translation: CAD44629.1 .
AJ506180 mRNA. Translation: CAD44630.1 .
AY177673 mRNA. Translation: AAO19641.1 .
AY320287 mRNA. Translation: AAP83943.1 .
CCDSi CCDS40517.1. [Q811T9-3 ]
CCDS52707.1. [Q811T9-1 ]
RefSeqi NP_777278.2. NM_174853.2. [Q811T9-3 ]
NP_777279.2. NM_174854.2. [Q811T9-1 ]
XP_006531084.1. XM_006531021.1. [Q811T9-1 ]
XP_006531085.1. XM_006531022.1. [Q811T9-1 ]
UniGenei Mm.233504.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 232675. 2 interactions.
DIPi DIP-54914N.
IntActi Q811T9. 5 interactions.

PTM databases

PhosphoSitei Q811T9.

Proteomic databases

PRIDEi Q811T9.

Protocols and materials databases

DNASUi 244667.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000075730 ; ENSMUSP00000075145 ; ENSMUSG00000043051 . [Q811T9-3 ]
ENSMUST00000098311 ; ENSMUSP00000095914 ; ENSMUSG00000043051 . [Q811T9-1 ]
ENSMUST00000117658 ; ENSMUSP00000112757 ; ENSMUSG00000043051 . [Q811T9-3 ]
ENSMUST00000118942 ; ENSMUSP00000112410 ; ENSMUSG00000043051 . [Q811T9-1 ]
ENSMUST00000121953 ; ENSMUSP00000112929 ; ENSMUSG00000043051 . [Q811T9-2 ]
ENSMUST00000122389 ; ENSMUSP00000112593 ; ENSMUSG00000043051 . [Q811T9-4 ]
GeneIDi 244667.
KEGGi mmu:244667.
UCSCi uc009nyc.1. mouse. [Q811T9-1 ]

Organism-specific databases

CTDi 27185.
MGIi MGI:2447658. Disc1.

Phylogenomic databases

eggNOGi NOG76097.
GeneTreei ENSGT00390000006176.
HOGENOMi HOG000056668.
HOVERGENi HBG051360.
InParanoidi Q811T9.
KOi K16534.
OMAi YMRSTAG.
OrthoDBi EOG7WT40R.
PhylomeDBi Q811T9.
TreeFami TF332357.

Miscellaneous databases

NextBioi 386371.
PROi Q811T9.
SOURCEi Search...

Gene expression databases

Bgeei Q811T9.
CleanExi MM_DISC1.
ExpressionAtlasi Q811T9. baseline.
Genevestigatori Q811T9.

Family and domain databases

InterProi IPR026081. DISC1.
[Graphical view ]
PANTHERi PTHR14332. PTHR14332. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Cloning and characterization of Disc1, the mouse ortholog of DISC1 (Disrupted-in-Schizophrenia 1)."
    Ma L., Liu Y., Ky B., Shughrue P.J., Austin C.P., Morris J.A.
    Genomics 80:662-672(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
    Strain: BALB/c.
  2. "Evolutionary constraints on the Disrupted in Schizophrenia locus."
    Taylor M.S., Devon R.S., Millar J.K., Porteous D.J.
    Genomics 81:67-77(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1-594 (ISOFORM 1).
    Strain: C57BL/6.
  3. "Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth."
    Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A.
    Proc. Natl. Acad. Sci. U.S.A. 100:289-294(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
  4. Erratum
    Ozeki Y., Tomoda T., Kleiderlein J., Kamiya A., Bord L., Fujii K., Okawa M., Yamada N., Hatten M.E., Snyder S.H., Ross C.A., Sawa A.
    Proc. Natl. Acad. Sci. U.S.A. 101:13969-13969(2004)
  5. "Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders."
    Brandon N.J., Handford E.J., Schurov I., Rain J.-C., Pelling M., Duran-Jimeniz B., Camargo L.M., Oliver K.R., Beher D., Shearman M.S., Whiting P.J.
    Mol. Cell. Neurosci. 25:42-55(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NDEL1, SUBCELLULAR LOCATION.
  6. "Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site."
    Brandon N.J., Schurov I., Camargo L.M., Handford E.J., Duran-Jimeniz B., Hunt P., Millar J.K., Porteous D.J., Shearman M.S., Whiting P.J.
    Mol. Cell. Neurosci. 28:613-624(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  7. "Disrupted-In-Schizophrenia 1 regulates integration of newly generated neurons in the adult brain."
    Duan X., Chang J.H., Ge S., Faulkner R.L., Kim J.Y., Kitabatake Y., Liu X.B., Yang C.H., Jordan J.D., Ma D.K., Liu C.Y., Ganesan S., Cheng H.J., Ming G.L., Lu B., Song H.
    Cell 130:1146-1158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  8. "Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling."
    Mao Y., Ge X., Frank C.L., Madison J.M., Koehler A.N., Doud M.K., Tassa C., Berry E.M., Soda T., Singh K.K., Biechele T., Petryshen T.L., Moon R.T., Haggarty S.J., Tsai L.H.
    Cell 136:1017-1031(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH GSK3B, DEVELOPMENTAL STAGE.
  9. "Disc1 regulates granule cell migration in the developing hippocampus."
    Meyer K.D., Morris J.A.
    Hum. Mol. Genet. 18:3286-3297(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  10. "DISC1 regulates new neuron development in the adult brain via modulation of AKT-mTOR signaling through KIAA1212."
    Kim J.Y., Duan X., Liu C.Y., Jang M.H., Guo J.U., Pow-anpongkul N., Kang E., Song H., Ming G.L.
    Neuron 63:761-773(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CCDC88A.
  11. "Deletion of densin-180 results in abnormal behaviors associated with mental illness and reduces mGluR5 and DISC1 in the postsynaptic density fraction."
    Carlisle H.J., Luong T.N., Medina-Marino A., Schenker L., Khorosheva E., Indersmitten T., Gunapala K.M., Steele A.D., O'Dell T.J., Patterson P.H., Kennedy M.B.
    J. Neurosci. 31:16194-16207(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiDISC1_MOUSE
AccessioniPrimary (citable) accession number: Q811T9
Secondary accession number(s): Q7TQ21
, Q8CF87, Q8CF88, Q8CHP1, Q8CHP2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: October 29, 2014
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3