Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q811D0

- DLG1_MOUSE

UniProt

Q811D0 - DLG1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disks large homolog 1

Gene

Dlg1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Essential multidomain scaffolding protein required for normal development. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels (By similarity). Functional regulator of Kv1.5 channel (By similarity). May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation.By similarity1 Publication

GO - Molecular functioni

  1. phosphatase binding Source: UniProtKB
  2. protein complex scaffold Source: MGI
  3. protein kinase binding Source: UniProtKB

GO - Biological processi

  1. actin filament organization Source: UniProtKB
  2. activation of protein kinase activity Source: MGI
  3. amyloid precursor protein metabolic process Source: MGI
  4. branching involved in ureteric bud morphogenesis Source: MGI
  5. cortical actin cytoskeleton organization Source: UniProtKB
  6. embryonic skeletal system morphogenesis Source: MGI
  7. endothelial cell proliferation Source: UniProtKB
  8. hard palate development Source: MGI
  9. immunological synapse formation Source: MGI
  10. lens development in camera-type eye Source: MGI
  11. membrane raft organization Source: MGI
  12. negative regulation of epithelial cell proliferation Source: MGI
  13. negative regulation of mitotic cell cycle Source: UniProtKB
  14. negative regulation of protein kinase B signaling Source: MGI
  15. negative regulation of T cell proliferation Source: MGI
  16. peristalsis Source: MGI
  17. positive regulation of actin filament polymerization Source: MGI
  18. positive regulation of cell proliferation Source: MGI
  19. positive regulation of developmental growth Source: UniProtKB
  20. positive regulation of establishment of protein localization to plasma membrane Source: Ensembl
  21. positive regulation of multicellular organism growth Source: UniProtKB
  22. positive regulation of potassium ion transport Source: Ensembl
  23. protein localization Source: MGI
  24. protein localization to plasma membrane Source: Ensembl
  25. regulation of membrane potential Source: MGI
  26. regulation of myelination Source: MGI
  27. reproductive structure development Source: MGI
  28. single organismal cell-cell adhesion Source: UniProtKB
  29. smooth muscle tissue development Source: MGI
  30. T cell activation Source: MGI
  31. T cell cytokine production Source: MGI
  32. tight junction assembly Source: Ensembl
  33. tissue morphogenesis Source: MGI
  34. ureteric bud development Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_198694. Activation of Ca-permeable Kainate Receptor.
REACT_230679. NrCAM interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 1
Alternative name(s):
Embryo-dlg/synapse-associated protein 97
Short name:
E-dlg/SAP97
Synapse-associated protein 97
Short name:
SAP-97
Short name:
SAP97
Gene namesi
Name:Dlg1
Synonyms:Dlgh1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 16

Organism-specific databases

MGIiMGI:107231. Dlg1.

Subcellular locationi

Membrane By similarity; Peripheral membrane protein By similarity. Basolateral cell membrane By similarity. Endoplasmic reticulum membrane By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse
Note: Colocalizes with EPB41 at regions of intercellular contacts. Basolateral in epithelial cells. May also associate with endoplasmic reticulum membranes. Mainly found in neurons soma, moderately found at postsynaptic densities (By similarity).By similarity

GO - Cellular componenti

  1. basal lamina Source: MGI
  2. basolateral plasma membrane Source: UniProtKB
  3. cell-cell adherens junction Source: UniProtKB
  4. cell junction Source: MGI
  5. cell projection membrane Source: MGI
  6. cytoplasmic side of plasma membrane Source: Ensembl
  7. endoplasmic reticulum Source: UniProtKB-KW
  8. extracellular vesicular exosome Source: Ensembl
  9. Golgi apparatus Source: Ensembl
  10. immunological synapse Source: MGI
  11. lateral loop Source: BHF-UCL
  12. lateral plasma membrane Source: MGI
  13. membrane raft Source: MGI
  14. microtubule Source: Ensembl
  15. MPP7-DLG1-LIN7 complex Source: Ensembl
  16. myelin sheath abaxonal region Source: BHF-UCL
  17. neuromuscular junction Source: MGI
  18. node of Ranvier Source: BHF-UCL
  19. nucleus Source: Ensembl
  20. perinuclear region of cytoplasm Source: Ensembl
  21. plasma membrane Source: MGI
  22. postsynaptic density Source: MGI
  23. postsynaptic membrane Source: UniProtKB-KW
  24. synapse Source: MGI
  25. tight junction Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice have craniofacial abnormalities as well as a cleft palate. They are smaller than heterozygous littermates, unable to feed and die within 24 hours of birth.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 905905Disks large homolog 1PRO_0000094549Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei122 – 1221PhosphoserineBy similarity
Modified residuei158 – 1581PhosphoserineBy similarity
Modified residuei232 – 2321PhosphoserineBy similarity
Modified residuei399 – 3991Phosphotyrosine1 Publication
Modified residuei568 – 5681PhosphoserineBy similarity
Modified residuei575 – 5751PhosphoserineBy similarity
Modified residuei619 – 6191PhosphoserineBy similarity
Modified residuei685 – 6851PhosphoserineBy similarity
Modified residuei688 – 6881PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ811D0.
PaxDbiQ811D0.
PRIDEiQ811D0.

PTM databases

PhosphoSiteiQ811D0.

Expressioni

Tissue specificityi

Expressed in epithelial, mesenchymal, neuronal, endothelial and hematopoietic cells during embryogenesis. Expressed in fibroblasts and T-cells. Widely expressed in adult mice.1 Publication

Gene expression databases

BgeeiQ811D0.
CleanExiMM_DLG1.
ExpressionAtlasiQ811D0. baseline and differential.
GenevestigatoriQ811D0.

Interactioni

Subunit structurei

Homotetramer (Probable). Interacts with KCNF1 and CAMK2 (By similarity). Interacts through its PDZ domains with KCND2 and KCND3 (By similarity). Interacts with CAMK2 (By similarity). Interacts through its PDZ domains with GRIN2A, KCNA1, KCNA2, KCNA3, KCNA4, KCNA5, GRIA1, GPR124 and GPR125. Interacts with cytoskeleton-associated proteins EPB41 and EZR. Found in a complex with KCNA5 and CAV3. Found in a complex with APC and CTNNB1. Interacts with CDH1 through binding to PIK3R1. Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12. Interacts through its guanylate kinase-like domain with DLGAP1, DLGAP2, DLGAP3, DLGAP4, MAP1A and KIF13B. Interacts with TOPK. Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C). May interact with TJAP1 (By similarity). May interact with HTR2A. Interacts with LRFN1, LRFN2, LRFN4 and SFPQ (By similarity). Interacts with PTEN (By similarity). Interacts with FRMPD4 (via C-terminus) (By similarity).By similarityCurated

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg4Q621083EBI-514290,EBI-300895
E6P064632EBI-514290,EBI-1186926From a different organism.
Lrfn2Q80TG93EBI-514290,EBI-877092
NrcamQ810U46EBI-514290,EBI-8321816

Protein-protein interaction databases

BioGridi199228. 15 interactions.
IntActiQ811D0. 13 interactions.
MINTiMINT-136497.

Structurei

Secondary structure

1
905
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi317 – 3237Combined sources
Beta strandi328 – 3358Combined sources
Beta strandi348 – 3536Combined sources
Helixi358 – 3625Combined sources
Beta strandi370 – 3745Combined sources
Helixi384 – 3929Combined sources
Beta strandi396 – 4038Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4OAJX-ray2.30A317-406[»]
ProteinModelPortaliQ811D0.
SMRiQ811D0. Positions 2-65, 221-905.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 6461L27PROSITE-ProRule annotationAdd
BLAST
Domaini224 – 31188PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini319 – 40688PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini466 – 54782PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini581 – 65171SH3PROSITE-ProRule annotationAdd
BLAST
Domaini715 – 890176Guanylate kinase-likePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni162 – 21251Interaction with SH3 domainsBy similarityAdd
BLAST

Domaini

The PDZ domains may also mediate association to membranes by binding to EPB41 and GPR124 together with the L27 domain that binds CASK and DLG2.By similarity
The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization (By similarity).By similarity

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 1 L27 domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ811D0.
KOiK12076.
OMAiFRREHAN.
OrthoDBiEOG79GT6P.
PhylomeDBiQ811D0.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR015143. L27_1.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119. PTHR23119. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q811D0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVRKQDTQR ALHLLEEYRS KLSQTEDRQL RSSIERVINI FQSNLFQALI
60 70 80 90 100
DIQEFYEVTL LDNPKCVDHS KQCEPVQPVT TWEIASLPST AVTSETLPGS
110 120 130 140 150
LSPPVEKYRY QDEEVLPPEH ISPQVTNEVL GPELVHVSEK NLSEIENVHG
160 170 180 190 200
FVSHSHISPI KPTEAVPPSS PIVPVTPALP VPAESTVVLP SAPQANPPPV
210 220 230 240 250
LVNTDSLETP TYVNGTDADY EYEEITLERG NSGLGFSIAG GTDNPHIGDD
260 270 280 290 300
SSIFITKIIT GGAAAQDGRL RVNDCILRVN EADVRDVTHS KAVEALKEAG
310 320 330 340 350
SIVRLYVKRR KPASEKIMEI KLIKGPKGLG FSIAGGVGNQ HIPGDNSIYV
360 370 380 390 400
TKIIEGGAAH KDGKLQIGDK LLAVNSVCLE EVTHEEAVTA LKNTSDFVYL
410 420 430 440 450
KVAKPTSMYI NDGYAPPDIT NSSSQSVDNH VSPSSCLGQT PTSPARYSPI
460 470 480 490 500
SKAVLGDDEI TREPRKVVLH RGSTGLGFNI VGGEDGEGIF ISFILAGGPA
510 520 530 540 550
DLSGELRKGD RIISVNSVDL RAASHEQAAA ALKNAGQAVT IVAQYRPEEY
560 570 580 590 600
SRFEAKIHDL REQMMNSSVS SGSGSLRTSQ KRSLYVRALF DYDKTKDSGL
610 620 630 640 650
PSQGLNFRFG DILHVINASD DEWWQARQVT PDGESDEVGV IPSKRRVEKK
660 670 680 690 700
ERARLKTVKF NSKTRGDKGE IPDDMGSKGL KHVTSNASDS ESSYRGQEEY
710 720 730 740 750
VLSYEPVNQQ EVNYTRPVII LGPMKDRVND DLISEFPDKF GSCVPHTTRP
760 770 780 790 800
KRDYEVDGRD YHFVTSREQM EKDIQEHKFI EAGQYNNHLY GTSVQSVRAV
810 820 830 840 850
AEKGKHCILD VSGNAIKRLQ IAQLYPISIF IKPKSMENIM EMNKRLTEEQ
860 870 880 890 900
ARKTFERAMK LEQEFTEHFT AIVQGDTLED IYNQVKQIIE EQSGPYIWVP

AKEKL
Length:905
Mass (Da):100,120
Last modified:June 1, 2003 - v1
Checksum:i950A465824AE3210
GO
Isoform 2 (identifier: Q811D0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     670-681: EIPDDMGSKGLK → SFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Note: Contains a phosphoserine at position 676.

Show »
Length:893
Mass (Da):99,630
Checksum:i085DFCCCC2067FEB
GO
Isoform 3 (identifier: Q811D0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-681: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Note: Contains a phosphoserine at position 710.

Show »
Length:927
Mass (Da):102,986
Checksum:i885671B7DACA7CD3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti263 – 2631A → R in AAC31653. (PubMed:9434093)Curated
Sequence conflicti276 – 2761I → V in AAC31653. (PubMed:9434093)Curated
Sequence conflicti312 – 3121P → L in AAC31653. (PubMed:9434093)Curated
Sequence conflicti337 – 3371V → I in AAC31653. (PubMed:9434093)Curated
Sequence conflicti470 – 4701H → R in AAN87264. 1 PublicationCurated
Sequence conflicti482 – 4821G → A in AAC31653. (PubMed:9434093)Curated
Sequence conflicti550 – 5512YS → SR in AAC31653. (PubMed:9434093)Curated
Sequence conflicti568 – 5681S → R in AAC31653. (PubMed:9434093)Curated
Sequence conflicti576 – 5761L → P in AAC31653. (PubMed:9434093)Curated
Sequence conflicti647 – 6471V → A in AAC31653. (PubMed:9434093)Curated
Sequence conflicti700 – 7001Y → C in AAC31653. (PubMed:9434093)Curated
Sequence conflicti754 – 7541Y → I in AAC31653. (PubMed:9434093)Curated
Sequence conflicti769 – 7702QM → RV in AAC31653. (PubMed:9434093)Curated
Sequence conflicti900 – 9001P → L in AAC31653. (PubMed:9434093)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei162 – 19433Missing in isoform 2. 1 PublicationVSP_012866Add
BLAST
Alternative sequencei670 – 68112EIPDD…SKGLK → SFNDKRKKNLFSRKFPFYKN KDQSEQETSDADQ in isoform 2. 1 PublicationVSP_012867Add
BLAST
Alternative sequencei670 – 68112EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 3. 2 PublicationsVSP_012868Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U93309 mRNA. Translation: AAC31653.1.
AY159380 mRNA. Translation: AAN87264.1.
BC047142 mRNA. Translation: AAH47142.1.
BC057118 mRNA. Translation: AAH57118.1.
CCDSiCCDS28107.1. [Q811D0-3]
CCDS57025.1. [Q811D0-1]
RefSeqiNP_001239362.1. NM_001252433.1. [Q811D0-2]
NP_001239363.1. NM_001252434.1.
NP_001239364.1. NM_001252435.1. [Q811D0-1]
NP_031888.2. NM_007862.3. [Q811D0-3]
XP_006521831.1. XM_006521768.1. [Q811D0-1]
UniGeneiMm.382.

Genome annotation databases

EnsembliENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770. [Q811D0-3]
ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770. [Q811D0-1]
ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770. [Q811D0-1]
GeneIDi13383.
KEGGimmu:13383.
UCSCiuc007yxo.2. mouse. [Q811D0-1]
uc007yxp.2. mouse. [Q811D0-3]
uc007yxs.2. mouse. [Q811D0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U93309 mRNA. Translation: AAC31653.1 .
AY159380 mRNA. Translation: AAN87264.1 .
BC047142 mRNA. Translation: AAH47142.1 .
BC057118 mRNA. Translation: AAH57118.1 .
CCDSi CCDS28107.1. [Q811D0-3 ]
CCDS57025.1. [Q811D0-1 ]
RefSeqi NP_001239362.1. NM_001252433.1. [Q811D0-2 ]
NP_001239363.1. NM_001252434.1.
NP_001239364.1. NM_001252435.1. [Q811D0-1 ]
NP_031888.2. NM_007862.3. [Q811D0-3 ]
XP_006521831.1. XM_006521768.1. [Q811D0-1 ]
UniGenei Mm.382.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4OAJ X-ray 2.30 A 317-406 [» ]
ProteinModelPortali Q811D0.
SMRi Q811D0. Positions 2-65, 221-905.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 199228. 15 interactions.
IntActi Q811D0. 13 interactions.
MINTi MINT-136497.

PTM databases

PhosphoSitei Q811D0.

Proteomic databases

MaxQBi Q811D0.
PaxDbi Q811D0.
PRIDEi Q811D0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000064477 ; ENSMUSP00000064280 ; ENSMUSG00000022770 . [Q811D0-3 ]
ENSMUST00000100001 ; ENSMUSP00000097581 ; ENSMUSG00000022770 . [Q811D0-1 ]
ENSMUST00000115205 ; ENSMUSP00000110859 ; ENSMUSG00000022770 . [Q811D0-1 ]
GeneIDi 13383.
KEGGi mmu:13383.
UCSCi uc007yxo.2. mouse. [Q811D0-1 ]
uc007yxp.2. mouse. [Q811D0-3 ]
uc007yxs.2. mouse. [Q811D0-2 ]

Organism-specific databases

CTDi 1739.
MGIi MGI:107231. Dlg1.

Phylogenomic databases

eggNOGi COG0194.
GeneTreei ENSGT00760000118866.
HOGENOMi HOG000232102.
HOVERGENi HBG107814.
InParanoidi Q811D0.
KOi K12076.
OMAi FRREHAN.
OrthoDBi EOG79GT6P.
PhylomeDBi Q811D0.
TreeFami TF323171.

Enzyme and pathway databases

Reactomei REACT_198694. Activation of Ca-permeable Kainate Receptor.
REACT_230679. NrCAM interactions.

Miscellaneous databases

ChiTaRSi Dlg1. mouse.
NextBioi 283732.
PROi Q811D0.
SOURCEi Search...

Gene expression databases

Bgeei Q811D0.
CleanExi MM_DLG1.
ExpressionAtlasi Q811D0. baseline and differential.
Genevestigatori Q811D0.

Family and domain databases

Gene3Di 2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProi IPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR015143. L27_1.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23119. PTHR23119. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
SMARTi SM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of the mouse homologue of human discs large and rat SAP97 genes."
    Lin L., Sahr K.E., Chishti A.H.
    Biochim. Biophys. Acta 1362:1-5(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Bone marrow.
  2. "Cloning and characterization of a novel mouse homolog E-dlg/SAP97 of the Drosophila discs large tumor suppressor binds to SAP102."
    Mao P., Tao Y.-X., Levine C., Tao F., Li D., Johns R.A.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6.
    Tissue: Brain and Colon.
  4. "Two independent domains of hDlg are sufficient for subcellular targeting: the PDZ1-2 conformational unit and an alternatively spliced domain."
    Lue R.A., Brandin E., Chan E.P., Branton D.
    J. Cell Biol. 135:1125-1137(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EZR.
  5. "Binding of APC to the human homolog of the Drosophila discs large tumor suppressor protein."
    Matsumine A., Ogai A., Senda T., Okumura N., Satoh K., Baeg G.-H., Kawahara T., Kobayashi S., Okada M., Toyoshima K., Akiyama T.
    Science 272:1020-1023(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH APC AND CTNNB1.
  6. "Craniofacial dysmorphogenesis including cleft palate in mice with an insertional mutation in the discs large gene."
    Caruana G., Bernstein A.
    Mol. Cell. Biol. 21:1475-1483(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  7. "Caveolin-3 and SAP97 form a scaffolding protein complex that regulates the voltage-gated potassium channel Kv1.5."
    Folco E.J., Liu G.-X., Koren G.
    Am. J. Physiol. 287:H681-H690(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KCNA5 AND CAV3.
  8. "The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins."
    Becamel C., Gavarini S., Chanrion B., Alonso G., Galeotti N., Dumuis A., Bockaert J., Marin P.
    J. Biol. Chem. 279:20257-20266(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HTR2A.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-676 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-710 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  10. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-399, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.

Entry informationi

Entry nameiDLG1_MOUSE
AccessioniPrimary (citable) accession number: Q811D0
Secondary accession number(s): Q62402, Q6PGB5, Q8CGN7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: June 1, 2003
Last modified: November 26, 2014
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3