Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 1

Gene

Dlg1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential multidomain scaffolding protein required for normal development. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels (By similarity). Functional regulator of Kv1.5 channel (By similarity). May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • actin filament organization Source: UniProtKB
  • activation of protein kinase activity Source: MGI
  • amyloid precursor protein metabolic process Source: MGI
  • astral microtubule organization Source: MGI
  • bicellular tight junction assembly Source: MGI
  • branching involved in ureteric bud morphogenesis Source: MGI
  • cellular protein complex localization Source: MGI
  • chemical synaptic transmission Source: GO_Central
  • cortical actin cytoskeleton organization Source: UniProtKB
  • cortical microtubule organization Source: MGI
  • embryonic skeletal system morphogenesis Source: MGI
  • endothelial cell proliferation Source: UniProtKB
  • establishment of centrosome localization Source: MGI
  • establishment or maintenance of epithelial cell apical/basal polarity Source: GO_Central
  • hard palate development Source: MGI
  • immunological synapse formation Source: MGI
  • lens development in camera-type eye Source: MGI
  • membrane raft organization Source: MGI
  • negative regulation of epithelial cell proliferation Source: MGI
  • negative regulation of ERK1 and ERK2 cascade Source: MGI
  • negative regulation of mitotic cell cycle Source: UniProtKB
  • negative regulation of p38MAPK cascade Source: MGI
  • negative regulation of protein kinase B signaling Source: MGI
  • negative regulation of T cell proliferation Source: MGI
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • peristalsis Source: MGI
  • positive regulation of actin filament polymerization Source: MGI
  • positive regulation of cell proliferation Source: MGI
  • positive regulation of developmental growth Source: UniProtKB
  • positive regulation of establishment of protein localization to plasma membrane Source: MGI
  • positive regulation of multicellular organism growth Source: UniProtKB
  • positive regulation of potassium ion transport Source: MGI
  • protein localization Source: MGI
  • protein localization to plasma membrane Source: MGI
  • receptor clustering Source: GO_Central
  • receptor localization to synapse Source: GO_Central
  • regulation of cell shape Source: MGI
  • regulation of membrane potential Source: MGI
  • regulation of myelination Source: MGI
  • reproductive structure development Source: MGI
  • single organismal cell-cell adhesion Source: UniProtKB
  • smooth muscle tissue development Source: MGI
  • T cell activation Source: MGI
  • T cell cytokine production Source: MGI
  • tissue morphogenesis Source: MGI
  • ureteric bud development Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-399719. Trafficking of AMPA receptors.
R-MMU-447038. NrCAM interactions.
R-MMU-451308. Activation of Ca-permeable Kainate Receptor.
R-MMU-8849932. SALM protein interactions at the synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 1
Alternative name(s):
Embryo-dlg/synapse-associated protein 97
Short name:
E-dlg/SAP97
Synapse-associated protein 97
Short name:
SAP-97
Short name:
SAP97
Gene namesi
Name:Dlg1
Synonyms:Dlgh1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:107231. Dlg1.

Subcellular locationi

GO - Cellular componenti

  • basal lamina Source: MGI
  • basolateral plasma membrane Source: UniProtKB
  • bicellular tight junction Source: MGI
  • cell-cell adherens junction Source: UniProtKB
  • cell-cell junction Source: MGI
  • cell junction Source: MGI
  • cell projection membrane Source: MGI
  • cytoplasm Source: MGI
  • cytoplasmic side of plasma membrane Source: MGI
  • cytosol Source: MGI
  • endoplasmic reticulum Source: MGI
  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • extracellular exosome Source: MGI
  • Golgi apparatus Source: MGI
  • immunological synapse Source: MGI
  • lateral loop Source: BHF-UCL
  • lateral plasma membrane Source: MGI
  • membrane raft Source: MGI
  • microtubule Source: MGI
  • microvillus Source: MGI
  • MPP7-DLG1-LIN7 complex Source: MGI
  • myelin sheath abaxonal region Source: BHF-UCL
  • neuromuscular junction Source: MGI
  • node of Ranvier Source: BHF-UCL
  • nucleus Source: MGI
  • paranode region of axon Source: MGI
  • perinuclear region of cytoplasm Source: MGI
  • plasma membrane Source: MGI
  • postsynaptic density Source: MGI
  • postsynaptic membrane Source: GO_Central
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice have craniofacial abnormalities as well as a cleft palate. They are smaller than heterozygous littermates, unable to feed and die within 24 hours of birth.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945491 – 905Disks large homolog 1Add BLAST905

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei122PhosphoserineBy similarity1
Modified residuei138PhosphoserineCombined sources1
Modified residuei158PhosphoserineBy similarity1
Modified residuei232PhosphoserineBy similarity1
Modified residuei399PhosphotyrosineCombined sources1
Modified residuei568PhosphoserineBy similarity1
Modified residuei573PhosphoserineCombined sources1
Modified residuei575PhosphoserineCombined sources1
Modified residuei579PhosphoserineBy similarity1
Modified residuei598PhosphoserineCombined sources1
Modified residuei619PhosphoserineCombined sources1
Modified residuei685PhosphoserineBy similarity1
Modified residuei688PhosphoserineBy similarity1
Modified residuei835PhosphoserineBy similarity1
Isoform 2 (identifier: Q811D0-2)
Modified residuei676PhosphoserineCombined sources1
Isoform 3 (identifier: Q811D0-3)
Modified residuei710PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by MAPK12. Phosphorylation of Ser-232 regulates association with GRIN2A (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ811D0.
PeptideAtlasiQ811D0.
PRIDEiQ811D0.

PTM databases

iPTMnetiQ811D0.
PhosphoSitePlusiQ811D0.
SwissPalmiQ811D0.

Expressioni

Tissue specificityi

Expressed in epithelial, mesenchymal, neuronal, endothelial and hematopoietic cells during embryogenesis. Expressed in fibroblasts and T-cells. Widely expressed in adult mice.1 Publication

Gene expression databases

BgeeiENSMUSG00000022770.
CleanExiMM_DLG1.
ExpressionAtlasiQ811D0. baseline and differential.
GenevisibleiQ811D0. MM.

Interactioni

Subunit structurei

Homotetramer (Probable). Interacts (via guanylate kinase-like domain) with DLGAP1, DLGAP2, DLGAP3, DLGAP4, and MAP1A (By similarity). Interacts (via guanylate kinase-like domain) with KIF13B (By similarity). May interact with HTR2A (PubMed:14988405). Interacts (via PDZ domains) with GRIA1 (By similarity). Interacts (via PDZ domains) with GRIN2A (By similarity). Interacts (via PDZ domains) with KCND2 and KCND3 (By similarity). Interacts (via PDZ domains) with KCNA1, KCNA2, KCNA3, KCNA4, and ADGRA3 (By similarity). Interacts (via PDZ domains) with ADGRA3 (By similarity). Interacts with KCNF1 (By similarity). Interacts with CAMK2 (By similarity). Interacts with CAMK2 (By similarity). Interacts with cytoskeleton-associated protein EPB41 (By similarity). Interacts with cytoskeleton-associated protein EZR (PubMed:8922391). Found in a complex with KCNA5 and CAV3 (PubMed:15277200). Found in a complex with APC and CTNNB1 (PubMed:8638125). Interacts with CDH1 through binding to PIK3R1 (By similarity). Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12 (By similarity). Interacts with TOPK (By similarity). Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C) (By similarity). May interact with TJAP1 (By similarity). Interacts with PTEN (By similarity). Interacts with LRFN1, LRFN2, LRFN4 and SFPQ (By similarity). Interacts with FRMPD4 (via C-terminus) (By similarity). Interacts (via PDZ domains) with ADGRA2 (via PDZ-binding motif) (PubMed:25558062).By similarityCurated4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg4Q621083EBI-514290,EBI-300895
E6P064632EBI-514290,EBI-1186926From a different organism.
Lrfn2Q80TG93EBI-514290,EBI-877092
NrcamQ810U46EBI-514290,EBI-8321816

GO - Molecular functioni

Protein-protein interaction databases

BioGridi199228. 11 interactors.
DIPiDIP-31591N.
IntActiQ811D0. 13 interactors.
MINTiMINT-136497.
STRINGi10090.ENSMUSP00000064280.

Structurei

Secondary structure

1905
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi317 – 323Combined sources7
Beta strandi328 – 335Combined sources8
Beta strandi348 – 353Combined sources6
Helixi358 – 362Combined sources5
Beta strandi370 – 374Combined sources5
Helixi384 – 392Combined sources9
Beta strandi396 – 403Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OAJX-ray2.30A317-406[»]
ProteinModelPortaliQ811D0.
SMRiQ811D0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini224 – 311PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini319 – 406PDZ 2PROSITE-ProRule annotationAdd BLAST88
Domaini466 – 547PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini581 – 651SH3PROSITE-ProRule annotationAdd BLAST71
Domaini715 – 890Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni162 – 212Interaction with SH3 domainsBy similarityAdd BLAST51

Domaini

The PDZ domains may also mediate association to membranes by binding to EPB41 and ADGRA2 together with the L27 domain that binds CASK and DLG2.By similarity
The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization (By similarity).By similarity

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 1 L27 domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ811D0.
KOiK12076.
OrthoDBiEOG091G0BB1.
PhylomeDBiQ811D0.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR015143. L27_1.
IPR004172. L27_dom.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q811D0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVRKQDTQR ALHLLEEYRS KLSQTEDRQL RSSIERVINI FQSNLFQALI
60 70 80 90 100
DIQEFYEVTL LDNPKCVDHS KQCEPVQPVT TWEIASLPST AVTSETLPGS
110 120 130 140 150
LSPPVEKYRY QDEEVLPPEH ISPQVTNEVL GPELVHVSEK NLSEIENVHG
160 170 180 190 200
FVSHSHISPI KPTEAVPPSS PIVPVTPALP VPAESTVVLP SAPQANPPPV
210 220 230 240 250
LVNTDSLETP TYVNGTDADY EYEEITLERG NSGLGFSIAG GTDNPHIGDD
260 270 280 290 300
SSIFITKIIT GGAAAQDGRL RVNDCILRVN EADVRDVTHS KAVEALKEAG
310 320 330 340 350
SIVRLYVKRR KPASEKIMEI KLIKGPKGLG FSIAGGVGNQ HIPGDNSIYV
360 370 380 390 400
TKIIEGGAAH KDGKLQIGDK LLAVNSVCLE EVTHEEAVTA LKNTSDFVYL
410 420 430 440 450
KVAKPTSMYI NDGYAPPDIT NSSSQSVDNH VSPSSCLGQT PTSPARYSPI
460 470 480 490 500
SKAVLGDDEI TREPRKVVLH RGSTGLGFNI VGGEDGEGIF ISFILAGGPA
510 520 530 540 550
DLSGELRKGD RIISVNSVDL RAASHEQAAA ALKNAGQAVT IVAQYRPEEY
560 570 580 590 600
SRFEAKIHDL REQMMNSSVS SGSGSLRTSQ KRSLYVRALF DYDKTKDSGL
610 620 630 640 650
PSQGLNFRFG DILHVINASD DEWWQARQVT PDGESDEVGV IPSKRRVEKK
660 670 680 690 700
ERARLKTVKF NSKTRGDKGE IPDDMGSKGL KHVTSNASDS ESSYRGQEEY
710 720 730 740 750
VLSYEPVNQQ EVNYTRPVII LGPMKDRVND DLISEFPDKF GSCVPHTTRP
760 770 780 790 800
KRDYEVDGRD YHFVTSREQM EKDIQEHKFI EAGQYNNHLY GTSVQSVRAV
810 820 830 840 850
AEKGKHCILD VSGNAIKRLQ IAQLYPISIF IKPKSMENIM EMNKRLTEEQ
860 870 880 890 900
ARKTFERAMK LEQEFTEHFT AIVQGDTLED IYNQVKQIIE EQSGPYIWVP

AKEKL
Length:905
Mass (Da):100,120
Last modified:June 1, 2003 - v1
Checksum:i950A465824AE3210
GO
Isoform 2 (identifier: Q811D0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: Missing.
     670-681: EIPDDMGSKGLK → SFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:893
Mass (Da):99,630
Checksum:i085DFCCCC2067FEB
GO
Isoform 3 (identifier: Q811D0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-681: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ

Show »
Length:927
Mass (Da):102,986
Checksum:i885671B7DACA7CD3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti263A → R in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti276I → V in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti312P → L in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti337V → I in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti470H → R in AAN87264 (Ref. 2) Curated1
Sequence conflicti482G → A in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti550 – 551YS → SR in AAC31653 (PubMed:9434093).Curated2
Sequence conflicti568S → R in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti576L → P in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti647V → A in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti700Y → C in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti754Y → I in AAC31653 (PubMed:9434093).Curated1
Sequence conflicti769 – 770QM → RV in AAC31653 (PubMed:9434093).Curated2
Sequence conflicti900P → L in AAC31653 (PubMed:9434093).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_012866162 – 194Missing in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_012867670 – 681EIPDD…SKGLK → SFNDKRKKNLFSRKFPFYKN KDQSEQETSDADQ in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_012868670 – 681EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 3. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U93309 mRNA. Translation: AAC31653.1.
AY159380 mRNA. Translation: AAN87264.1.
BC047142 mRNA. Translation: AAH47142.1.
BC057118 mRNA. Translation: AAH57118.1.
CCDSiCCDS28107.1. [Q811D0-3]
CCDS57025.1. [Q811D0-1]
RefSeqiNP_001239362.1. NM_001252433.1. [Q811D0-2]
NP_001239363.1. NM_001252434.1.
NP_001239364.1. NM_001252435.1. [Q811D0-1]
NP_031888.2. NM_007862.3. [Q811D0-3]
XP_006521831.1. XM_006521768.3. [Q811D0-1]
UniGeneiMm.382.

Genome annotation databases

EnsembliENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770. [Q811D0-3]
ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770. [Q811D0-1]
ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770. [Q811D0-1]
GeneIDi13383.
KEGGimmu:13383.
UCSCiuc007yxo.2. mouse. [Q811D0-1]
uc007yxp.2. mouse. [Q811D0-3]
uc007yxs.2. mouse. [Q811D0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U93309 mRNA. Translation: AAC31653.1.
AY159380 mRNA. Translation: AAN87264.1.
BC047142 mRNA. Translation: AAH47142.1.
BC057118 mRNA. Translation: AAH57118.1.
CCDSiCCDS28107.1. [Q811D0-3]
CCDS57025.1. [Q811D0-1]
RefSeqiNP_001239362.1. NM_001252433.1. [Q811D0-2]
NP_001239363.1. NM_001252434.1.
NP_001239364.1. NM_001252435.1. [Q811D0-1]
NP_031888.2. NM_007862.3. [Q811D0-3]
XP_006521831.1. XM_006521768.3. [Q811D0-1]
UniGeneiMm.382.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OAJX-ray2.30A317-406[»]
ProteinModelPortaliQ811D0.
SMRiQ811D0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199228. 11 interactors.
DIPiDIP-31591N.
IntActiQ811D0. 13 interactors.
MINTiMINT-136497.
STRINGi10090.ENSMUSP00000064280.

PTM databases

iPTMnetiQ811D0.
PhosphoSitePlusiQ811D0.
SwissPalmiQ811D0.

Proteomic databases

PaxDbiQ811D0.
PeptideAtlasiQ811D0.
PRIDEiQ811D0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770. [Q811D0-3]
ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770. [Q811D0-1]
ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770. [Q811D0-1]
GeneIDi13383.
KEGGimmu:13383.
UCSCiuc007yxo.2. mouse. [Q811D0-1]
uc007yxp.2. mouse. [Q811D0-3]
uc007yxs.2. mouse. [Q811D0-2]

Organism-specific databases

CTDi1739.
MGIiMGI:107231. Dlg1.

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ811D0.
KOiK12076.
OrthoDBiEOG091G0BB1.
PhylomeDBiQ811D0.
TreeFamiTF323171.

Enzyme and pathway databases

ReactomeiR-MMU-399719. Trafficking of AMPA receptors.
R-MMU-447038. NrCAM interactions.
R-MMU-451308. Activation of Ca-permeable Kainate Receptor.
R-MMU-8849932. SALM protein interactions at the synapses.

Miscellaneous databases

ChiTaRSiDlg1. mouse.
PROiQ811D0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022770.
CleanExiMM_DLG1.
ExpressionAtlasiQ811D0. baseline and differential.
GenevisibleiQ811D0. MM.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR015143. L27_1.
IPR004172. L27_dom.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLG1_MOUSE
AccessioniPrimary (citable) accession number: Q811D0
Secondary accession number(s): Q62402, Q6PGB5, Q8CGN7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 151 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.