Q811D0 (DLG1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 1 Alternative name(s): Embryo-dlg/synapse-associated protein 97 Short name=E-dlg/SAP97 Synapse-associated protein 97 Short name=SAP-97 Short name=SAP97 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 905 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential multidomain scaffolding protein required for normal development. Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels By similarity. Functional regulator of Kv1.5 channel By similarity. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Ref.6 |
| Subunit structure | Homotetramer Probable. Interacts with KCNF1 and CAMK2 By similarity. Interacts through its PDZ domains with KCND2 and KCND3 By similarity. Interacts with CAMK2 By similarity. Interacts through its PDZ domains with GRIN2A, KCNA1, KCNA2, KCNA3, KCNA4, KCNA5, GRIA1, GPR124 and GPR125. Interacts with cytoskeleton-associated proteins EPB41 and EZR. Found in a complex with KCNA5 and CAV3. Found in a complex with APC and CTNNB1. Interacts with CDH1 through binding to PIK3R1. Forms multiprotein complexes with CASK, LIN7A, LIN7B, LIN7C, APBA1, and KCNJ12. Interacts through its guanylate kinase-like domain with DLGAP1, DLGAP2, DLGAP3, DLGAP4, MAP1A and KIF13B. Interacts with TOPK. Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C). May interact with TJAP1 By similarity. May interact with HTR2A. Interacts with LRFN1, LRFN2, LRFN4 and SFPQ By similarity. Interacts with PTEN By similarity. Interacts with FRMPD4 (via C-terminus) By similarity. Ref.4 Ref.5 Ref.7 Ref.8 |
| Subcellular location | Membrane; Peripheral membrane protein By similarity. Basolateral cell membrane By similarity. Endoplasmic reticulum membrane By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse. Note: Colocalizes with EPB41 at regions of intercellular contacts. Basolateral in epithelial cells. May also associate with endoplasmic reticulum membranes. Mainly found in neurons soma, moderately found at postsynaptic densities By similarity. |
| Tissue specificity | Expressed in epithelial, mesenchymal, neuronal, endothelial and hematopoietic cells during embryogenesis. Expressed in fibroblasts and T-cells. Widely expressed in adult mice. Ref.6 |
| Domain | The PDZ domains may also mediate association to membranes by binding to EPB41 and GPR124 together with the L27 domain that binds CASK and DLG2 By similarity. The L27 domain may regulate DLG1 self-association. The N-terminal alternatively spliced region is capable of binding several SH3 domains and also moderates the level of protein oligomerization By similarity. |
| Post-translational modification | Phosphorylated by MAPK12 By similarity. Phosphorylation of Ser-232 regulates association with GRIN2A By similarity. Isoform 2 is phosphorylated on Ser-665. Isoform 3 is phosphorylated on Ser-699. |
| Disruption phenotype | Mice have craniofacial abnormalities as well as a cleft palate. They are smaller than heterozygous littermates, unable to feed and die within 24 hours of birth. Ref.6 |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 1 L27 domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Dlg4 | Q62108 | 3 | EBI-514290,EBI-300895 | |
| Lrfn2 | Q80TG9 | 3 | EBI-514290,EBI-877092 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q811D0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q811D0-2) The sequence of this isoform differs from the canonical sequence as follows: 162-194: Missing. 670-681: EIPDDMGSKGLK → SFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ | ||||||
| Note: Contains a phosphoserine at position 665. | ||||||
| Isoform 3 (identifier: Q811D0-3) The sequence of this isoform differs from the canonical sequence as follows: 670-681: EIPDDMGSKGLK → QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQ | ||||||
| Note: Contains a phosphoserine at position 699. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 905 | 905 | Disks large homolog 1 | PRO_0000094549 | |||||
Regions | |||||||||
| Domain | 4 – 64 | 61 | L27 | ||||||
| Domain | 224 – 311 | 88 | PDZ 1 | ||||||
| Domain | 319 – 406 | 88 | PDZ 2 | ||||||
| Domain | 466 – 547 | 82 | PDZ 3 | ||||||
| Domain | 581 – 651 | 71 | SH3 | ||||||
| Domain | 715 – 890 | 176 | Guanylate kinase-like | ||||||
| Region | 162 – 212 | 51 | Interaction with SH3 domains By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 122 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 158 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 232 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 301 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 399 | 1 | Phosphotyrosine Ref.10 | ||||||
| Modified residue | 568 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 575 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 619 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 684 | 1 | Phosphothreonine Ref.11 | ||||||
| Modified residue | 685 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 688 | 1 | Phosphoserine Ref.12 | ||||||
Natural variations | |||||||||
| Alternative sequence | 162 – 194 | 33 | Missing in isoform 2. | VSP_012866 | |||||
| Alternative sequence | 670 – 681 | 12 | EIPDD…SKGLK → SFNDKRKKNLFSRKFPFYKN KDQSEQETSDADQ in isoform 2. | VSP_012867 | |||||
| Alternative sequence | 670 – 681 | 12 | EIPDD…SKGLK → QSFNDKRKKNLFSRKFPFYK NKDQSEQETSDADQ in isoform 3. | VSP_012868 | |||||
Experimental info | |||||||||
| Sequence conflict | 263 | 1 | A → R in AAC31653. Ref.1 | ||||||
| Sequence conflict | 276 | 1 | I → V in AAC31653. Ref.1 | ||||||
| Sequence conflict | 312 | 1 | P → L in AAC31653. Ref.1 | ||||||
| Sequence conflict | 337 | 1 | V → I in AAC31653. Ref.1 | ||||||
| Sequence conflict | 470 | 1 | H → R in AAN87264. Ref.2 | ||||||
| Sequence conflict | 482 | 1 | G → A in AAC31653. Ref.1 | ||||||
| Sequence conflict | 550 – 551 | 2 | YS → SR in AAC31653. Ref.1 | ||||||
| Sequence conflict | 568 | 1 | S → R in AAC31653. Ref.1 | ||||||
| Sequence conflict | 576 | 1 | L → P in AAC31653. Ref.1 | ||||||
| Sequence conflict | 647 | 1 | V → A in AAC31653. Ref.1 | ||||||
| Sequence conflict | 700 | 1 | Y → C in AAC31653. Ref.1 | ||||||
| Sequence conflict | 754 | 1 | Y → I in AAC31653. Ref.1 | ||||||
| Sequence conflict | 769 – 770 | 2 | QM → RV in AAC31653. Ref.1 | ||||||
| Sequence conflict | 900 | 1 | P → L in AAC31653. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of the mouse homologue of human discs large and rat SAP97 genes." Lin L., Sahr K.E., Chishti A.H. Biochim. Biophys. Acta 1362:1-5(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Bone marrow. |
| [2] | "Cloning and characterization of a novel mouse homolog E-dlg/SAP97 of the Drosophila discs large tumor suppressor binds to SAP102." Mao P., Tao Y.-X., Levine C., Tao F., Li D., Johns R.A. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: C57BL/6. Tissue: Brain and Colon. |
| [4] | "Two independent domains of hDlg are sufficient for subcellular targeting: the PDZ1-2 conformational unit and an alternatively spliced domain." Lue R.A., Brandin E., Chan E.P., Branton D. J. Cell Biol. 135:1125-1137(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EZR. |
| [5] | "Binding of APC to the human homolog of the Drosophila discs large tumor suppressor protein." Matsumine A., Ogai A., Senda T., Okumura N., Satoh K., Baeg G.-H., Kawahara T., Kobayashi S., Okada M., Toyoshima K., Akiyama T. Science 272:1020-1023(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH APC AND CTNNB1. |
| [6] | "Craniofacial dysmorphogenesis including cleft palate in mice with an insertional mutation in the discs large gene." Caruana G., Bernstein A. Mol. Cell. Biol. 21:1475-1483(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [7] | "Caveolin-3 and SAP97 form a scaffolding protein complex that regulates the voltage-gated potassium channel Kv1.5." Folco E.J., Liu G.-X., Koren G. Am. J. Physiol. 287:H681-H690(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KCNA5 AND CAV3. |
| [8] | "The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins." Becamel C., Gavarini S., Chanrion B., Alonso G., Galeotti N., Dumuis A., Bockaert J., Marin P. J. Biol. Chem. 279:20257-20266(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTR2A. |
| [9] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-301, MASS SPECTROMETRY. Tissue: Brain. |
| [10] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-399, MASS SPECTROMETRY. Tissue: Brain. |
| [11] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-684, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-665 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Liver. |
| [12] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-688, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U93309 mRNA. Translation: AAC31653.1. AY159380 mRNA. Translation: AAN87264.1. BC047142 mRNA. Translation: AAH47142.1. BC057118 mRNA. Translation: AAH57118.1. |
| IPI | IPI00125861. IPI00408668. IPI00553807. |
| RefSeq | NP_001239362.1. NM_001252433.1. NP_001239363.1. NM_001252434.1. NP_001239364.1. NM_001252435.1. NP_031888.2. NM_007862.3. |
| UniGene | Mm.382. |
3D structure databases | |
| ProteinModelPortal | Q811D0. |
| SMR | Q811D0. Positions 2-65, 221-902. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q811D0. 6 interactions. |
| MINT | MINT-136497. |
PTM databases | |
| PhosphoSite | Q811D0. |
Proteomic databases | |
| PaxDb | Q811D0. |
| PRIDE | Q811D0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000064477; ENSMUSP00000064280; ENSMUSG00000022770. ENSMUST00000100001; ENSMUSP00000097581; ENSMUSG00000022770. ENSMUST00000115205; ENSMUSP00000110859; ENSMUSG00000022770. |
| GeneID | 13383. |
| KEGG | mmu:13383. |
| UCSC | uc007yxo.1. mouse. uc007yxp.1. mouse. uc007yxs.1. mouse. |
Organism-specific databases | |
| CTD | 1739. |
| MGI | MGI:107231. Dlg1. |
Phylogenomic databases | |
| eggNOG | COG0194. |
| GeneTree | ENSGT00660000095130. |
| HOGENOM | HOG000232102. |
| HOVERGEN | HBG107814. |
| KO | K12076. |
| OrthoDB | EOG447FSN. |
Enzyme and pathway databases | |
| Reactome | REACT_127416. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q811D0. |
| Bgee | Q811D0. |
| CleanEx | MM_DLG1. |
| Genevestigator | Q811D0. |
| GermOnline | ENSMUSG00000022770. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR004172. L27. IPR015143. L27_1. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF00625. Guanylate_kin. 1 hit. PF09058. L27_1. 1 hit. PF10608. MAGUK_N_PEST. 1 hit. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] |
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. |
| SMART | SM00072. GuKc. 1 hit. SM00569. L27. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. |
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS51022. L27. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | dlg1. mouse. |
| NextBio | 283732. |
| SOURCE | Search... |
Entry information
| Entry name | DLG1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q811D0 Secondary accession number(s): Q62402, Q6PGB5, Q8CGN7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
