Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q810U4 (NRCAM_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 122. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Neuronal cell adhesion molecule

Short name=Nr-CAM
Alternative name(s):
Neuronal surface protein Bravo
Short name=mBravo
NgCAM-related cell adhesion molecule
Short name=Ng-CAM-related
Gene names
Name:Nrcam
Synonyms:Kiaa0343
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1256 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier. Ref.5

Subunit structure

Probable constituent of a neurofascin/NRCAM/ankyrin-G complex By similarity. Interacts with GLDN/gliomedin and MYOC. Ref.5 Ref.6

Subcellular location

Cell membrane; Single-pass type I membrane protein.

Sequence similarities

Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.

Contains 4 fibronectin type-III domains.

Contains 6 Ig-like C2-type (immunoglobulin-like) domains.

Sequence caution

The sequence BAC65534.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAD65848.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processangiogenesis

Inferred from electronic annotation. Source: Ensembl

axon guidance

Inferred from direct assay PubMed 12182881. Source: UniProtKB

central nervous system development

Inferred from direct assay PubMed 12182881. Source: UniProtKB

clustering of voltage-gated sodium channels

Inferred from sequence or structural similarity. Source: UniProtKB

heterotypic cell-cell adhesion

Inferred from genetic interaction PubMed 20188654. Source: GOC

neuronal action potential propagation

Inferred from mutant phenotype PubMed 14602817. Source: MGI

protein localization

Inferred from direct assay PubMed 16882004. Source: MGI

regulation of neuron projection development

Inferred from mutant phenotype PubMed 16701205. Source: MGI

retinal ganglion cell axon guidance

Inferred from mutant phenotype PubMed 16701205. Source: MGI

single organismal cell-cell adhesion

Inferred from direct assay PubMed 12182881. Source: UniProtKB

   Cellular_componentaxon

Inferred from direct assay PubMed 14602817. Source: MGI

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from direct assay PubMed 16882004. Source: MGI

synapse

Inferred from direct assay PubMed 16882004. Source: MGI

   Molecular_functionankyrin binding

Inferred from sequence or structural similarity. Source: UniProtKB

protein binding

Inferred from physical interaction Ref.6. Source: UniProtKB

protein binding involved in heterotypic cell-cell adhesion

Inferred from genetic interaction PubMed 20188654. Source: MGI

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q810U4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q810U4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     629-638: Missing.
     1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK
Note: No experimental confirmation available.
Isoform 3 (identifier: Q810U4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: Y → YRSFE
Note: No experimental confirmation available.
Isoform 4 (identifier: Q810U4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     254-259: AKSSKE → GELQWL
     260-1256: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q810U4-5)

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → DPKLLHD
     235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
     255-1256: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 12561227Neuronal cell adhesion molecule
PRO_0000015058

Regions

Topological domain30 – 11191090Extracellular Potential
Transmembrane1120 – 114223Helical; Potential
Topological domain1143 – 1256114Cytoplasmic Potential
Domain40 – 12889Ig-like C2-type 1
Domain135 – 22995Ig-like C2-type 2
Domain261 – 35090Ig-like C2-type 3
Domain355 – 44288Ig-like C2-type 4
Domain448 – 53588Ig-like C2-type 5
Domain539 – 62688Ig-like C2-type 6
Domain643 – 73896Fibronectin type-III 1
Domain740 – 83798Fibronectin type-III 2
Domain842 – 944103Fibronectin type-III 3
Domain948 – 104598Fibronectin type-III 4

Amino acid modifications

Modified residue12231Phosphoserine By similarity
Glycosylation771N-linked (GlcNAc...) Potential
Glycosylation2171N-linked (GlcNAc...) Potential
Glycosylation2391N-linked (GlcNAc...) Potential
Glycosylation2451N-linked (GlcNAc...) Potential
Glycosylation2701N-linked (GlcNAc...) Potential
Glycosylation3081N-linked (GlcNAc...) Potential
Glycosylation3711N-linked (GlcNAc...) Potential
Glycosylation4271N-linked (GlcNAc...) Potential
Glycosylation5011N-linked (GlcNAc...) Potential
Glycosylation6131N-linked (GlcNAc...) Potential
Glycosylation7101N-linked (GlcNAc...) Potential
Glycosylation7961N-linked (GlcNAc...) Potential
Glycosylation8521N-linked (GlcNAc...) Potential
Glycosylation9871N-linked (GlcNAc...) Potential
Glycosylation10031N-linked (GlcNAc...) Potential
Glycosylation10131N-linked (GlcNAc...) Potential
Glycosylation10671N-linked (GlcNAc...) Potential
Disulfide bond62 ↔ 117 Potential
Disulfide bond161 ↔ 212 Potential
Disulfide bond286 ↔ 334 Potential
Disulfide bond376 ↔ 426 Potential
Disulfide bond470 ↔ 519 Potential
Disulfide bond561 ↔ 610 Potential

Natural variations

Alternative sequence351D → DPKLLHD in isoform 5.
VSP_008921
Alternative sequence235 – 25420VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5.
VSP_008922
Alternative sequence254 – 2596AKSSKE → GELQWL in isoform 4.
VSP_008923
Alternative sequence255 – 12561002Missing in isoform 5.
VSP_008924
Alternative sequence260 – 1256997Missing in isoform 4.
VSP_008925
Alternative sequence629 – 63810Missing in isoform 2.
VSP_008926
Alternative sequence1045 – 110763AGIPP…FETGP → GKK in isoform 2.
VSP_008927
Alternative sequence11771Y → YRSFE in isoform 3.
VSP_008930

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 14, 2003. Version 2.
Checksum: F3F698C2AF3FCFFA

FASTA1,256138,522
        10         20         30         40         50         60 
MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY IIDPRENIVI 

        70         80         90        100        110        120 
QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI NIMSEGKAET YEGVYQCTAR 

       130        140        150        160        170        180 
NERGAAVSNN IVVRPSRSPL WTKERLEPIV LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ 

       190        200        210        220        230        240 
RLPQSERVSQ GLNGDLYFSN VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND 

       250        260        270        280        290        300 
TIAANLSDTE FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK 

       310        320        330        340        350        360 
EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT VKAAPYWIVA 

       370        380        390        400        410        420 
PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD DPSRKIDGDT IIFSNVQESS 

       430        440        450        460        470        480 
SAVYQCNASN KYGYLLANAF VNVLAEPPRI LTSANTLYQV IANRPALLDC AFFGSPMPTI 

       490        500        510        520        530        540 
EWFKGTKGSA LHEDIYVLHD NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT 

       550        560        570        580        590        600 
RIIKQPEYAV VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV 

       610        620        630        640        650        660 
KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT NQLDKSVQLT 

       670        680        690        700        710        720 
WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT AQLKLSPYVN YSFRVMAENS 

       730        740        750        760        770        780 
IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW 

       790        800        810        820        830        840 
RQKDGDDEWT SVVVANVSKY IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM 

       850        860        870        880        890        900 
VAPGNVRVSV VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF 

       910        920        930        940        950        960 
QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS SLKIVNPTLD 

       970        980        990       1000       1010       1020 
SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI PANKTRWTLK NLNFSTRYKF 

      1030       1040       1050       1060       1070       1080 
YFYAQTSVGP GSQITEEAIT TVDEAGIPPP DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP 

      1090       1100       1110       1120       1130       1140 
GTAYKVRVGA EGDSGFVSSE DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC 

      1150       1160       1170       1180       1190       1200 
FIRRNKGGKY PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK 

      1210       1220       1230       1240       1250 
EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN AMNSFV 

« Hide

Isoform 2 [UniParc].

Checksum: 959FBD8D4384F861
Show »

FASTA1,186131,274
Isoform 3 [UniParc].

Checksum: D1CF15B186D22420
Show »

FASTA1,260139,041
Isoform 4 [UniParc].

Checksum: EB3687E24A1CABED
Show »

FASTA25929,063
Isoform 5 [UniParc].

Checksum: 1794BD3DC8E9A6E2
Show »

FASTA26028,964

References

« Hide 'large scale' references
[1]"Expression patterns of L1-family cell recognition molecules L1, CHL1, NrCAM, and neurofascin in the mouse brain."
Dirks P., Montag-Sallaz M., Montag D.
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Swiss Webster.
Tissue: Brain.
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1094-1256 (ISOFORM 3).
Strain: C57BL/6J.
Tissue: Spinal cord.
[4]Lubec G., Kang S.U.
Submitted (APR-2007) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 432-449 AND 705-723, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: C57BL/6.
Tissue: Brain.
[5]"Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier."
Eshed Y., Feinberg K., Poliak S., Sabanay H., Sarig-Nadir O., Spiegel I., Bermingham J.R. Jr., Peles E.
Neuron 47:215-229(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH GLDN.
[6]"Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling."
Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.
J. Biol. Chem. 288:26357-26371(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH MYOC.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
AK122252 mRNA. Translation: BAC65534.1. Different initiation.
AK039322 mRNA. Translation: BAC30318.1.
AK048567 mRNA. Translation: BAC33377.1.
AK045259 mRNA. Translation: BAC32284.1.
CCDSCCDS49056.1. [Q810U4-1]
CCDS49057.1. [Q810U4-2]
RefSeqNP_001139503.1. NM_001146031.1. [Q810U4-2]
NP_795904.3. NM_176930.4. [Q810U4-1]
UniGeneMm.208439.

3D structure databases

ProteinModelPortalQ810U4.
SMRQ810U4. Positions 36-827, 836-1048.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid235320. 2 interactions.
IntActQ810U4. 3 interactions.
MINTMINT-3090404.

PTM databases

PhosphoSiteQ810U4.

Proteomic databases

MaxQBQ810U4.
PaxDbQ810U4.
PRIDEQ810U4.

Protocols and materials databases

DNASU319504.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
GeneID319504.
KEGGmmu:319504.
UCSCuc007nls.2. mouse. [Q810U4-5]
uc007nlt.2. mouse. [Q810U4-2]
uc007nlu.2. mouse. [Q810U4-1]
uc007nlw.1. mouse. [Q810U4-4]

Organism-specific databases

CTD4897.
MGIMGI:104750. Nrcam.
RougeSearch...

Phylogenomic databases

eggNOGNOG293951.
GeneTreeENSGT00720000108572.
HOGENOMHOG000231380.
HOVERGENHBG000144.
KOK06756.
OMAYANISWE.
OrthoDBEOG7R56RM.
PhylomeDBQ810U4.
TreeFamTF351098.

Enzyme and pathway databases

ReactomeREACT_188576. Developmental Biology.

Gene expression databases

ArrayExpressQ810U4.
BgeeQ810U4.
CleanExMM_NRCAM.
GenevestigatorQ810U4.

Family and domain databases

Gene3D2.60.40.10. 10 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 3 hits.
[Graphical view]
SMARTSM00060. FN3. 4 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 2 hits.
PROSITEPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNRCAM. mouse.
NextBio394866.
PROQ810U4.
SOURCESearch...

Entry information

Entry nameNRCAM_MOUSE
AccessionPrimary (citable) accession number: Q810U4
Secondary accession number(s): Q80U33 expand/collapse secondary AC list , Q8BLG8, Q8BX92, Q8BYJ8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: November 14, 2003
Last modified: July 9, 2014
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot