Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q810U4

- NRCAM_MOUSE

UniProt

Q810U4 - NRCAM_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuronal cell adhesion molecule

Gene

Nrcam

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.1 Publication

GO - Molecular functioni

  1. ankyrin binding Source: UniProtKB
  2. protein binding involved in heterotypic cell-cell adhesion Source: MGI

GO - Biological processi

  1. angiogenesis Source: Ensembl
  2. axon guidance Source: UniProtKB
  3. central nervous system development Source: UniProtKB
  4. clustering of voltage-gated sodium channels Source: UniProtKB
  5. heterotypic cell-cell adhesion Source: GOC
  6. neuronal action potential propagation Source: MGI
  7. protein localization Source: MGI
  8. regulation of neuron projection development Source: MGI
  9. retinal ganglion cell axon guidance Source: MGI
  10. single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal cell adhesion molecule
Short name:
Nr-CAM
Alternative name(s):
Neuronal surface protein Bravo
Short name:
mBravo
NgCAM-related cell adhesion molecule
Short name:
Ng-CAM-related
Gene namesi
Name:Nrcam
Synonyms:Kiaa0343
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 12

Organism-specific databases

MGIiMGI:104750. Nrcam.

Subcellular locationi

GO - Cellular componenti

  1. axon Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: MGI
  4. synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 12561227Neuronal cell adhesion moleculePRO_0000015058Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi62 ↔ 117PROSITE-ProRule annotation
Glycosylationi77 – 771N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi161 ↔ 212PROSITE-ProRule annotation
Glycosylationi217 – 2171N-linked (GlcNAc...)Sequence Analysis
Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
Glycosylationi245 – 2451N-linked (GlcNAc...)Sequence Analysis
Glycosylationi270 – 2701N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi286 ↔ 334PROSITE-ProRule annotation
Glycosylationi308 – 3081N-linked (GlcNAc...)Sequence Analysis
Glycosylationi371 – 3711N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi376 ↔ 426PROSITE-ProRule annotation
Glycosylationi427 – 4271N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi470 ↔ 519PROSITE-ProRule annotation
Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi561 ↔ 610PROSITE-ProRule annotation
Glycosylationi613 – 6131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi710 – 7101N-linked (GlcNAc...)Sequence Analysis
Glycosylationi796 – 7961N-linked (GlcNAc...)Sequence Analysis
Glycosylationi852 – 8521N-linked (GlcNAc...)Sequence Analysis
Glycosylationi987 – 9871N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1003 – 10031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1013 – 10131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi1067 – 10671N-linked (GlcNAc...)Sequence Analysis
Modified residuei1223 – 12231PhosphoserineBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ810U4.
PaxDbiQ810U4.
PRIDEiQ810U4.

PTM databases

PhosphoSiteiQ810U4.

Expressioni

Gene expression databases

BgeeiQ810U4.
CleanExiMM_NRCAM.
ExpressionAtlasiQ810U4. baseline and differential.
GenevestigatoriQ810U4.

Interactioni

Subunit structurei

Probable constituent of a neurofascin/NRCAM/ankyrin-G complex By similarity. Interacts with GLDN/gliomedin and MYOC.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg1Q811D06EBI-8321816,EBI-514290
Dlg4Q621082EBI-8321816,EBI-300895

Protein-protein interaction databases

BioGridi235320. 2 interactions.
IntActiQ810U4. 3 interactions.
MINTiMINT-3090404.

Structurei

3D structure databases

ProteinModelPortaliQ810U4.
SMRiQ810U4. Positions 36-827, 836-1048.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 11191090ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1143 – 1256114CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1120 – 114223HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini40 – 12889Ig-like C2-type 1Add
BLAST
Domaini135 – 22995Ig-like C2-type 2Add
BLAST
Domaini261 – 35090Ig-like C2-type 3Add
BLAST
Domaini355 – 44288Ig-like C2-type 4Add
BLAST
Domaini448 – 53588Ig-like C2-type 5Add
BLAST
Domaini539 – 62688Ig-like C2-type 6Add
BLAST
Domaini643 – 73896Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini740 – 83798Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini842 – 944103Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini948 – 104598Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG293951.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiQ810U4.
KOiK06756.
OMAiYANISWE.
OrthoDBiEOG7R56RM.
PhylomeDBiQ810U4.
TreeFamiTF351098.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 3 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q810U4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY
60 70 80 90 100
IIDPRENIVI QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI
110 120 130 140 150
NIMSEGKAET YEGVYQCTAR NERGAAVSNN IVVRPSRSPL WTKERLEPIV
160 170 180 190 200
LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ RLPQSERVSQ GLNGDLYFSN
210 220 230 240 250
VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND TIAANLSDTE
260 270 280 290 300
FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK
310 320 330 340 350
EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT
360 370 380 390 400
VKAAPYWIVA PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD
410 420 430 440 450
DPSRKIDGDT IIFSNVQESS SAVYQCNASN KYGYLLANAF VNVLAEPPRI
460 470 480 490 500
LTSANTLYQV IANRPALLDC AFFGSPMPTI EWFKGTKGSA LHEDIYVLHD
510 520 530 540 550
NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT RIIKQPEYAV
560 570 580 590 600
VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV
610 620 630 640 650
KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT
660 670 680 690 700
NQLDKSVQLT WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT
710 720 730 740 750
AQLKLSPYVN YSFRVMAENS IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL
760 770 780 790 800
GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW RQKDGDDEWT SVVVANVSKY
810 820 830 840 850
IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM VAPGNVRVSV
860 870 880 890 900
VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF
910 920 930 940 950
QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS
960 970 980 990 1000
SLKIVNPTLD SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI
1010 1020 1030 1040 1050
PANKTRWTLK NLNFSTRYKF YFYAQTSVGP GSQITEEAIT TVDEAGIPPP
1060 1070 1080 1090 1100
DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP GTAYKVRVGA EGDSGFVSSE
1110 1120 1130 1140 1150
DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC FIRRNKGGKY
1160 1170 1180 1190 1200
PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK
1210 1220 1230 1240 1250
EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN

AMNSFV
Length:1,256
Mass (Da):138,522
Last modified:November 14, 2003 - v2
Checksum:iF3F698C2AF3FCFFA
GO
Isoform 2 (identifier: Q810U4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     629-638: Missing.
     1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK

Note: No experimental confirmation available.

Show »
Length:1,186
Mass (Da):131,274
Checksum:i959FBD8D4384F861
GO
Isoform 3 (identifier: Q810U4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: Y → YRSFE

Note: No experimental confirmation available.

Show »
Length:1,260
Mass (Da):139,041
Checksum:iD1CF15B186D22420
GO
Isoform 4 (identifier: Q810U4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     254-259: AKSSKE → GELQWL
     260-1256: Missing.

Note: No experimental confirmation available.

Show »
Length:259
Mass (Da):29,063
Checksum:iEB3687E24A1CABED
GO
Isoform 5 (identifier: Q810U4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → DPKLLHD
     235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
     255-1256: Missing.

Note: No experimental confirmation available.

Show »
Length:260
Mass (Da):28,964
Checksum:i1794BD3DC8E9A6E2
GO

Sequence cautioni

The sequence BAC65534.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAD65848.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei35 – 351D → DPKLLHD in isoform 5. 1 PublicationVSP_008921
Alternative sequencei235 – 25420VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. 1 PublicationVSP_008922Add
BLAST
Alternative sequencei254 – 2596AKSSKE → GELQWL in isoform 4. 1 PublicationVSP_008923
Alternative sequencei255 – 12561002Missing in isoform 5. 1 PublicationVSP_008924Add
BLAST
Alternative sequencei260 – 1256997Missing in isoform 4. 1 PublicationVSP_008925Add
BLAST
Alternative sequencei629 – 63810Missing in isoform 2. 1 PublicationVSP_008926
Alternative sequencei1045 – 110763AGIPP…FETGP → GKK in isoform 2. 1 PublicationVSP_008927Add
BLAST
Alternative sequencei1177 – 11771Y → YRSFE in isoform 3. 1 PublicationVSP_008930

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
AK122252 mRNA. Translation: BAC65534.1. Different initiation.
AK039322 mRNA. Translation: BAC30318.1.
AK048567 mRNA. Translation: BAC33377.1.
AK045259 mRNA. Translation: BAC32284.1.
CCDSiCCDS49056.1. [Q810U4-1]
CCDS49057.1. [Q810U4-2]
RefSeqiNP_001139503.1. NM_001146031.1. [Q810U4-2]
NP_795904.3. NM_176930.4. [Q810U4-1]
UniGeneiMm.208439.

Genome annotation databases

EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
GeneIDi319504.
KEGGimmu:319504.
UCSCiuc007nls.2. mouse. [Q810U4-5]
uc007nlt.2. mouse. [Q810U4-2]
uc007nlu.2. mouse. [Q810U4-1]
uc007nlw.1. mouse. [Q810U4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ543321 mRNA. Translation: CAD65848.1 . Different initiation.
AK122252 mRNA. Translation: BAC65534.1 . Different initiation.
AK039322 mRNA. Translation: BAC30318.1 .
AK048567 mRNA. Translation: BAC33377.1 .
AK045259 mRNA. Translation: BAC32284.1 .
CCDSi CCDS49056.1. [Q810U4-1 ]
CCDS49057.1. [Q810U4-2 ]
RefSeqi NP_001139503.1. NM_001146031.1. [Q810U4-2 ]
NP_795904.3. NM_176930.4. [Q810U4-1 ]
UniGenei Mm.208439.

3D structure databases

ProteinModelPortali Q810U4.
SMRi Q810U4. Positions 36-827, 836-1048.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 235320. 2 interactions.
IntActi Q810U4. 3 interactions.
MINTi MINT-3090404.

PTM databases

PhosphoSitei Q810U4.

Proteomic databases

MaxQBi Q810U4.
PaxDbi Q810U4.
PRIDEi Q810U4.

Protocols and materials databases

DNASUi 319504.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000020939 ; ENSMUSP00000020939 ; ENSMUSG00000020598 . [Q810U4-1 ]
ENSMUST00000110748 ; ENSMUSP00000106376 ; ENSMUSG00000020598 . [Q810U4-2 ]
GeneIDi 319504.
KEGGi mmu:319504.
UCSCi uc007nls.2. mouse. [Q810U4-5 ]
uc007nlt.2. mouse. [Q810U4-2 ]
uc007nlu.2. mouse. [Q810U4-1 ]
uc007nlw.1. mouse. [Q810U4-4 ]

Organism-specific databases

CTDi 4897.
MGIi MGI:104750. Nrcam.
Rougei Search...

Phylogenomic databases

eggNOGi NOG293951.
GeneTreei ENSGT00760000118840.
HOGENOMi HOG000231380.
HOVERGENi HBG000144.
InParanoidi Q810U4.
KOi K06756.
OMAi YANISWE.
OrthoDBi EOG7R56RM.
PhylomeDBi Q810U4.
TreeFami TF351098.

Miscellaneous databases

ChiTaRSi NRCAM. mouse.
NextBioi 394866.
PROi Q810U4.
SOURCEi Search...

Gene expression databases

Bgeei Q810U4.
CleanExi MM_NRCAM.
ExpressionAtlasi Q810U4. baseline and differential.
Genevestigatori Q810U4.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view ]
Pfami PF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 3 hits.
[Graphical view ]
SMARTi SM00060. FN3. 4 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
PROSITEi PS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression patterns of L1-family cell recognition molecules L1, CHL1, NrCAM, and neurofascin in the mouse brain."
    Dirks P., Montag-Sallaz M., Montag D.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster.
    Tissue: Brain.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1094-1256 (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Spinal cord.
  4. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 432-449 AND 705-723, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  5. "Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier."
    Eshed Y., Feinberg K., Poliak S., Sabanay H., Sarig-Nadir O., Spiegel I., Bermingham J.R. Jr., Peles E.
    Neuron 47:215-229(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH GLDN.
  6. "Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling."
    Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.
    J. Biol. Chem. 288:26357-26371(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MYOC.

Entry informationi

Entry nameiNRCAM_MOUSE
AccessioniPrimary (citable) accession number: Q810U4
Secondary accession number(s): Q80U33
, Q8BLG8, Q8BX92, Q8BYJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: November 14, 2003
Last modified: October 29, 2014
This is version 125 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3