Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q810U4

- NRCAM_MOUSE

UniProt

Q810U4 - NRCAM_MOUSE

Protein

Neuronal cell adhesion molecule

Gene

Nrcam

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 2 (14 Nov 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.1 Publication

    GO - Molecular functioni

    1. ankyrin binding Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. protein binding involved in heterotypic cell-cell adhesion Source: MGI

    GO - Biological processi

    1. angiogenesis Source: Ensembl
    2. axon guidance Source: UniProtKB
    3. central nervous system development Source: UniProtKB
    4. clustering of voltage-gated sodium channels Source: UniProtKB
    5. heterotypic cell-cell adhesion Source: GOC
    6. neuronal action potential propagation Source: MGI
    7. protein localization Source: MGI
    8. regulation of neuron projection development Source: MGI
    9. retinal ganglion cell axon guidance Source: MGI
    10. single organismal cell-cell adhesion Source: UniProtKB

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neuronal cell adhesion molecule
    Short name:
    Nr-CAM
    Alternative name(s):
    Neuronal surface protein Bravo
    Short name:
    mBravo
    NgCAM-related cell adhesion molecule
    Short name:
    Ng-CAM-related
    Gene namesi
    Name:Nrcam
    Synonyms:Kiaa0343
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 12

    Organism-specific databases

    MGIiMGI:104750. Nrcam.

    Subcellular locationi

    GO - Cellular componenti

    1. axon Source: MGI
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: MGI
    4. synapse Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 12561227Neuronal cell adhesion moleculePRO_0000015058Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi62 ↔ 117PROSITE-ProRule annotation
    Glycosylationi77 – 771N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi161 ↔ 212PROSITE-ProRule annotation
    Glycosylationi217 – 2171N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi245 – 2451N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi270 – 2701N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi286 ↔ 334PROSITE-ProRule annotation
    Glycosylationi308 – 3081N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi371 – 3711N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi376 ↔ 426PROSITE-ProRule annotation
    Glycosylationi427 – 4271N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi470 ↔ 519PROSITE-ProRule annotation
    Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi561 ↔ 610PROSITE-ProRule annotation
    Glycosylationi613 – 6131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi710 – 7101N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi796 – 7961N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi852 – 8521N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi987 – 9871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1003 – 10031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1013 – 10131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi1067 – 10671N-linked (GlcNAc...)Sequence Analysis
    Modified residuei1223 – 12231PhosphoserineBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ810U4.
    PaxDbiQ810U4.
    PRIDEiQ810U4.

    PTM databases

    PhosphoSiteiQ810U4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ810U4.
    BgeeiQ810U4.
    CleanExiMM_NRCAM.
    GenevestigatoriQ810U4.

    Interactioni

    Subunit structurei

    Probable constituent of a neurofascin/NRCAM/ankyrin-G complex By similarity. Interacts with GLDN/gliomedin and MYOC.By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Dlg1Q811D06EBI-8321816,EBI-514290
    Dlg4Q621082EBI-8321816,EBI-300895

    Protein-protein interaction databases

    BioGridi235320. 2 interactions.
    IntActiQ810U4. 3 interactions.
    MINTiMINT-3090404.

    Structurei

    3D structure databases

    ProteinModelPortaliQ810U4.
    SMRiQ810U4. Positions 36-827, 836-1048.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini30 – 11191090ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1143 – 1256114CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1120 – 114223HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini40 – 12889Ig-like C2-type 1Add
    BLAST
    Domaini135 – 22995Ig-like C2-type 2Add
    BLAST
    Domaini261 – 35090Ig-like C2-type 3Add
    BLAST
    Domaini355 – 44288Ig-like C2-type 4Add
    BLAST
    Domaini448 – 53588Ig-like C2-type 5Add
    BLAST
    Domaini539 – 62688Ig-like C2-type 6Add
    BLAST
    Domaini643 – 73896Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini740 – 83798Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini842 – 944103Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini948 – 104598Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG293951.
    GeneTreeiENSGT00720000108572.
    HOGENOMiHOG000231380.
    HOVERGENiHBG000144.
    KOiK06756.
    OMAiYANISWE.
    OrthoDBiEOG7R56RM.
    PhylomeDBiQ810U4.
    TreeFamiTF351098.

    Family and domain databases

    Gene3Di2.60.40.10. 10 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003006. Ig/MHC_CS.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR026966. Neurofascin/L1/NrCAM_C.
    [Graphical view]
    PfamiPF13882. Bravo_FIGEY. 1 hit.
    PF00041. fn3. 4 hits.
    PF07679. I-set. 3 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 4 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 5 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    PROSITEiPS50853. FN3. 4 hits.
    PS50835. IG_LIKE. 6 hits.
    PS00290. IG_MHC. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q810U4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY     50
    IIDPRENIVI QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI 100
    NIMSEGKAET YEGVYQCTAR NERGAAVSNN IVVRPSRSPL WTKERLEPIV 150
    LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ RLPQSERVSQ GLNGDLYFSN 200
    VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND TIAANLSDTE 250
    FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK 300
    EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT 350
    VKAAPYWIVA PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD 400
    DPSRKIDGDT IIFSNVQESS SAVYQCNASN KYGYLLANAF VNVLAEPPRI 450
    LTSANTLYQV IANRPALLDC AFFGSPMPTI EWFKGTKGSA LHEDIYVLHD 500
    NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT RIIKQPEYAV 550
    VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV 600
    KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT 650
    NQLDKSVQLT WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT 700
    AQLKLSPYVN YSFRVMAENS IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL 750
    GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW RQKDGDDEWT SVVVANVSKY 800
    IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM VAPGNVRVSV 850
    VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF 900
    QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS 950
    SLKIVNPTLD SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI 1000
    PANKTRWTLK NLNFSTRYKF YFYAQTSVGP GSQITEEAIT TVDEAGIPPP 1050
    DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP GTAYKVRVGA EGDSGFVSSE 1100
    DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC FIRRNKGGKY 1150
    PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK 1200
    EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN 1250
    AMNSFV 1256
    Length:1,256
    Mass (Da):138,522
    Last modified:November 14, 2003 - v2
    Checksum:iF3F698C2AF3FCFFA
    GO
    Isoform 2 (identifier: Q810U4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         629-638: Missing.
         1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK

    Note: No experimental confirmation available.

    Show »
    Length:1,186
    Mass (Da):131,274
    Checksum:i959FBD8D4384F861
    GO
    Isoform 3 (identifier: Q810U4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1177-1177: Y → YRSFE

    Note: No experimental confirmation available.

    Show »
    Length:1,260
    Mass (Da):139,041
    Checksum:iD1CF15B186D22420
    GO
    Isoform 4 (identifier: Q810U4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         254-259: AKSSKE → GELQWL
         260-1256: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:259
    Mass (Da):29,063
    Checksum:iEB3687E24A1CABED
    GO
    Isoform 5 (identifier: Q810U4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         35-35: D → DPKLLHD
         235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
         255-1256: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:260
    Mass (Da):28,964
    Checksum:i1794BD3DC8E9A6E2
    GO

    Sequence cautioni

    The sequence BAC65534.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD65848.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei35 – 351D → DPKLLHD in isoform 5. 1 PublicationVSP_008921
    Alternative sequencei235 – 25420VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. 1 PublicationVSP_008922Add
    BLAST
    Alternative sequencei254 – 2596AKSSKE → GELQWL in isoform 4. 1 PublicationVSP_008923
    Alternative sequencei255 – 12561002Missing in isoform 5. 1 PublicationVSP_008924Add
    BLAST
    Alternative sequencei260 – 1256997Missing in isoform 4. 1 PublicationVSP_008925Add
    BLAST
    Alternative sequencei629 – 63810Missing in isoform 2. 1 PublicationVSP_008926
    Alternative sequencei1045 – 110763AGIPP…FETGP → GKK in isoform 2. 1 PublicationVSP_008927Add
    BLAST
    Alternative sequencei1177 – 11771Y → YRSFE in isoform 3. 1 PublicationVSP_008930

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
    AK122252 mRNA. Translation: BAC65534.1. Different initiation.
    AK039322 mRNA. Translation: BAC30318.1.
    AK048567 mRNA. Translation: BAC33377.1.
    AK045259 mRNA. Translation: BAC32284.1.
    CCDSiCCDS49056.1. [Q810U4-1]
    CCDS49057.1. [Q810U4-2]
    RefSeqiNP_001139503.1. NM_001146031.1. [Q810U4-2]
    NP_795904.3. NM_176930.4. [Q810U4-1]
    UniGeneiMm.208439.

    Genome annotation databases

    EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
    ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
    GeneIDi319504.
    KEGGimmu:319504.
    UCSCiuc007nls.2. mouse. [Q810U4-5]
    uc007nlt.2. mouse. [Q810U4-2]
    uc007nlu.2. mouse. [Q810U4-1]
    uc007nlw.1. mouse. [Q810U4-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ543321 mRNA. Translation: CAD65848.1 . Different initiation.
    AK122252 mRNA. Translation: BAC65534.1 . Different initiation.
    AK039322 mRNA. Translation: BAC30318.1 .
    AK048567 mRNA. Translation: BAC33377.1 .
    AK045259 mRNA. Translation: BAC32284.1 .
    CCDSi CCDS49056.1. [Q810U4-1 ]
    CCDS49057.1. [Q810U4-2 ]
    RefSeqi NP_001139503.1. NM_001146031.1. [Q810U4-2 ]
    NP_795904.3. NM_176930.4. [Q810U4-1 ]
    UniGenei Mm.208439.

    3D structure databases

    ProteinModelPortali Q810U4.
    SMRi Q810U4. Positions 36-827, 836-1048.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 235320. 2 interactions.
    IntActi Q810U4. 3 interactions.
    MINTi MINT-3090404.

    PTM databases

    PhosphoSitei Q810U4.

    Proteomic databases

    MaxQBi Q810U4.
    PaxDbi Q810U4.
    PRIDEi Q810U4.

    Protocols and materials databases

    DNASUi 319504.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000020939 ; ENSMUSP00000020939 ; ENSMUSG00000020598 . [Q810U4-1 ]
    ENSMUST00000110748 ; ENSMUSP00000106376 ; ENSMUSG00000020598 . [Q810U4-2 ]
    GeneIDi 319504.
    KEGGi mmu:319504.
    UCSCi uc007nls.2. mouse. [Q810U4-5 ]
    uc007nlt.2. mouse. [Q810U4-2 ]
    uc007nlu.2. mouse. [Q810U4-1 ]
    uc007nlw.1. mouse. [Q810U4-4 ]

    Organism-specific databases

    CTDi 4897.
    MGIi MGI:104750. Nrcam.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG293951.
    GeneTreei ENSGT00720000108572.
    HOGENOMi HOG000231380.
    HOVERGENi HBG000144.
    KOi K06756.
    OMAi YANISWE.
    OrthoDBi EOG7R56RM.
    PhylomeDBi Q810U4.
    TreeFami TF351098.

    Miscellaneous databases

    ChiTaRSi NRCAM. mouse.
    NextBioi 394866.
    PROi Q810U4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q810U4.
    Bgeei Q810U4.
    CleanExi MM_NRCAM.
    Genevestigatori Q810U4.

    Family and domain databases

    Gene3Di 2.60.40.10. 10 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003006. Ig/MHC_CS.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR026966. Neurofascin/L1/NrCAM_C.
    [Graphical view ]
    Pfami PF13882. Bravo_FIGEY. 1 hit.
    PF00041. fn3. 4 hits.
    PF07679. I-set. 3 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 4 hits.
    SM00409. IG. 1 hit.
    SM00408. IGc2. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    PROSITEi PS50853. FN3. 4 hits.
    PS50835. IG_LIKE. 6 hits.
    PS00290. IG_MHC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression patterns of L1-family cell recognition molecules L1, CHL1, NrCAM, and neurofascin in the mouse brain."
      Dirks P., Montag-Sallaz M., Montag D.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: Swiss Webster.
      Tissue: Brain.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1094-1256 (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Spinal cord.
    4. Lubec G., Kang S.U.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 432-449 AND 705-723, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: C57BL/6.
      Tissue: Brain.
    5. "Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier."
      Eshed Y., Feinberg K., Poliak S., Sabanay H., Sarig-Nadir O., Spiegel I., Bermingham J.R. Jr., Peles E.
      Neuron 47:215-229(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH GLDN.
    6. "Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling."
      Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.
      J. Biol. Chem. 288:26357-26371(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MYOC.

    Entry informationi

    Entry nameiNRCAM_MOUSE
    AccessioniPrimary (citable) accession number: Q810U4
    Secondary accession number(s): Q80U33
    , Q8BLG8, Q8BX92, Q8BYJ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 14, 2003
    Last sequence update: November 14, 2003
    Last modified: October 1, 2014
    This is version 124 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3