Q810U4 (NRCAM_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Neuronal cell adhesion molecule Short name=Nr-CAM Alternative name(s): Neuronal surface protein Bravo Short name=mBravo NgCAM-related cell adhesion molecule Short name=Ng-CAM-related | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1256 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier. Ref.5 |
| Subunit structure | Probable constituent of a neurofascin/NRCAM/ankyrin-G complex By similarity. Interacts with GLDN/gliomedin. Ref.5 |
| Subcellular location | |
| Sequence similarities | Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family. Contains 4 fibronectin type-III domains. Contains 6 Ig-like C2-type (immunoglobulin-like) domains. |
| Sequence caution | The sequence BAC65534.1 differs from that shown. Reason: Erroneous initiation. The sequence CAD65848.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q810U4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q810U4-2) The sequence of this isoform differs from the canonical sequence as follows: 629-638: Missing. 1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q810U4-3) The sequence of this isoform differs from the canonical sequence as follows: 1177-1177: Y → YRSFE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q810U4-4) The sequence of this isoform differs from the canonical sequence as follows: 254-259: AKSSKE → GELQWL 260-1256: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q810U4-5) The sequence of this isoform differs from the canonical sequence as follows: 35-35: D → DPKLLHD 235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY 255-1256: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | ||||||||
| Chain | 30 – 1256 | 1227 | Neuronal cell adhesion molecule | PRO_0000015058 | |||||||
Regions | |||||||||||
| Topological domain | 30 – 1119 | 1090 | Extracellular Potential | ||||||||
| Transmembrane | 1120 – 1142 | 23 | Helical; Potential | ||||||||
| Topological domain | 1143 – 1256 | 114 | Cytoplasmic Potential | ||||||||
| Domain | 40 – 128 | 89 | Ig-like C2-type 1 | ||||||||
| Domain | 135 – 229 | 95 | Ig-like C2-type 2 | ||||||||
| Domain | 261 – 350 | 90 | Ig-like C2-type 3 | ||||||||
| Domain | 355 – 442 | 88 | Ig-like C2-type 4 | ||||||||
| Domain | 448 – 535 | 88 | Ig-like C2-type 5 | ||||||||
| Domain | 539 – 626 | 88 | Ig-like C2-type 6 | ||||||||
| Domain | 641 – 733 | 93 | Fibronectin type-III 1 | ||||||||
| Domain | 740 – 834 | 95 | Fibronectin type-III 2 | ||||||||
| Domain | 839 – 940 | 102 | Fibronectin type-III 3 | ||||||||
| Domain | 946 – 1040 | 95 | Fibronectin type-III 4 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 421 | 1 | Phosphoserine Ref.7 | ||||||||
| Modified residue | 1178 | 1 | Phosphoserine Ref.8 | ||||||||
| Modified residue | 1247 | 1 | Phosphoserine Ref.6 | ||||||||
| Glycosylation | 77 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 217 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 239 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 245 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 270 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 308 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 371 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 427 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 501 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 613 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 710 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 796 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 852 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 987 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1003 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1013 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1067 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 62 ↔ 117 | Potential | |||||||||
| Disulfide bond | 161 ↔ 212 | Potential | |||||||||
| Disulfide bond | 286 ↔ 334 | Potential | |||||||||
| Disulfide bond | 376 ↔ 426 | Potential | |||||||||
| Disulfide bond | 470 ↔ 519 | Potential | |||||||||
| Disulfide bond | 561 ↔ 610 | Potential | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 35 | 1 | D → DPKLLHD in isoform 5. | VSP_008921 | |||||||
| Alternative sequence | 235 – 254 | 20 | VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. | VSP_008922 | |||||||
| Alternative sequence | 254 – 259 | 6 | AKSSKE → GELQWL in isoform 4. | VSP_008923 | |||||||
| Alternative sequence | 255 – 1256 | 1002 | Missing in isoform 5. | VSP_008924 | |||||||
| Alternative sequence | 260 – 1256 | 997 | Missing in isoform 4. | VSP_008925 | |||||||
| Alternative sequence | 629 – 638 | 10 | Missing in isoform 2. | VSP_008926 | |||||||
| Alternative sequence | 1045 – 1107 | 63 | AGIPP…FETGP → GKK in isoform 2. | VSP_008927 | |||||||
| Alternative sequence | 1177 | 1 | Y → YRSFE in isoform 3. | VSP_008930 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression patterns of L1-family cell recognition molecules L1, CHL1, NrCAM, and neurofascin in the mouse brain." Dirks P., Montag-Sallaz M., Montag D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: Swiss Webster. Tissue: Brain. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1094-1256 (ISOFORM 3). Strain: C57BL/6J. Tissue: Spinal cord. |
| [4] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 432-449 AND 705-723, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [5] | "Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier." Eshed Y., Feinberg K., Poliak S., Sabanay H., Sarig-Nadir O., Spiegel I., Bermingham J.R. Jr., Peles E. Neuron 47:215-229(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH GLDN. |
| [6] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1247, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [7] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-421, MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1178, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ543321 mRNA. Translation: CAD65848.1. Different initiation. AK122252 mRNA. Translation: BAC65534.1. Different initiation. AK039322 mRNA. Translation: BAC30318.1. AK048567 mRNA. Translation: BAC33377.1. AK045259 mRNA. Translation: BAC32284.1. |
| IPI | IPI00226573. IPI00338880. IPI00395042. IPI00395043. IPI00403536. |
| RefSeq | NP_001139503.1. NM_001146031.1. NP_795904.3. NM_176930.4. |
| UniGene | Mm.208439. |
3D structure databases | |
| ProteinModelPortal | Q810U4. |
| SMR | Q810U4. Positions 36-827, 836-1048. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-3090404. |
PTM databases | |
| PhosphoSite | Q810U4. |
Proteomic databases | |
| PaxDb | Q810U4. |
| PRIDE | Q810U4. |
Protocols and materials databases | |
| DNASU | 319504. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. |
| GeneID | 319504. |
| KEGG | mmu:319504. |
| UCSC | uc007nls.2. mouse. uc007nlt.2. mouse. uc007nlu.2. mouse. uc007nlw.1. mouse. |
Organism-specific databases | |
| CTD | 4897. |
| MGI | MGI:104750. Nrcam. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG293951. |
| GeneTree | ENSGT00690000101868. |
| HOGENOM | HOG000231380. |
| HOVERGEN | HBG000144. |
| KO | K06756. |
| OMA | YANISWE. |
| OrthoDB | EOG4GTKC3. |
Enzyme and pathway databases | |
| Reactome | REACT_127416. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q810U4. |
| Bgee | Q810U4. |
| CleanEx | MM_NRCAM. |
| Genevestigator | Q810U4. |
| GermOnline | ENSMUSG00000020598. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 10 hits. |
| InterPro | IPR026966. Fibronectin_III_C. IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003006. Ig/MHC_CS. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. [Graphical view] |
| Pfam | PF13882. Bravo_FIGEY. 1 hit. PF00041. fn3. 4 hits. PF07679. I-set. 3 hits. [Graphical view] |
| SMART | SM00060. FN3. 4 hits. SM00409. IG. 1 hit. SM00408. IGc2. 5 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 4 hits. |
| PROSITE | PS50853. FN3. 5 hits. PS50835. IG_LIKE. 6 hits. PS00290. IG_MHC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | NRCAM. mouse. |
| NextBio | 394866. |
| SOURCE | Search... |
Entry information
| Entry name | NRCAM_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q810U4 Secondary accession number(s): Q80U33 Q8BYJ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
