Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Neuronal cell adhesion molecule

Gene

Nrcam

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion protein that is required for normal responses to cell-cell contacts in brain and in the peripheral nervous system. Plays a role in neurite outgrowth in response to contactin binding (PubMed:11564762). Plays a role in mediating cell-cell contacts between Schwann cells and axons (PubMed:20188654). Plays a role in the formation and maintenance of the nodes of Ranvier on myelinated axons. Nodes of Ranvier contain clustered sodium channels that are crucial for the saltatory propagation of action potentials along myelinated axons. During development, nodes of Ranvier are formed by the fusion of two heminodes. Required for normal clustering of sodium channels at heminodes; not required for the formation of mature nodes with normal sodium channel clusters (PubMed:14602817, PubMed:20188654). Required, together with GLDN, for maintaining NFASC and sodium channel clusters at mature nodes of Ranvier (PubMed:24719088).5 Publications

GO - Molecular functioni

  • ankyrin binding Source: UniProtKB
  • protein binding involved in heterotypic cell-cell adhesion Source: MGI

GO - Biological processi

  • angiogenesis Source: Ensembl
  • axon guidance Source: UniProtKB
  • central nervous system development Source: UniProtKB
  • clustering of voltage-gated sodium channels Source: UniProtKB
  • neuronal action potential propagation Source: MGI
  • protein localization Source: MGI
  • regulation of neuron projection development Source: MGI
  • retinal ganglion cell axon guidance Source: MGI
  • single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-447038. NrCAM interactions.
R-MMU-447043. Neurofascin interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal cell adhesion molecule
Short name:
Nr-CAM
Alternative name(s):
Neuronal surface protein Bravo
Short name:
mBravo
NgCAM-related cell adhesion molecule
Short name:
Ng-CAM-related
Gene namesi
Name:Nrcam
Synonyms:Kiaa0343
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:104750. Nrcam.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 1119ExtracellularSequence analysisAdd BLAST1090
Transmembranei1120 – 1142HelicalSequence analysisAdd BLAST23
Topological domaini1143 – 1256CytoplasmicSequence analysisAdd BLAST114

GO - Cellular componenti

  • axon Source: MGI
  • extracellular region Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: MGI
  • synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Mice are born at the expected Mendelian rate, are viable and fertile. They present no obvious phenotype excepting subtle size differences of cerebellar lobes IV and V. Contrary to wild-type, cerebellar cells do not form neurites when plated on a surface coated with contactin (in vitro) (PubMed:11564762). Neonates present delayed formation of sodium channel clusters at developing nodes of Ranvier, but are indistiguishable from wild-type at 10 days after birth (PubMed:14602817, PubMed:20188654). Mice lacking both Gldn and Nrcam are born at the expected Mendelian rate, but are smaller than control littermates and display important neurological impairments, in spite of seemingly normal nerve myelination. Motor abnormalities vary between individuals, ranging from ataxia, uncoordinated movements and premature death to weakness of the hind limbs, hypomotility, strongly impaired ability to hang from a horizontal bar with their forelimbs and a tendency to stumble. The motor defects correlate with decreased velocity of nerve conduction and slower propagation of action potentials. Most mice die within 60 days after birth, and none are fertile. Mutant mice display delayed formation of mature nodes of Ranvier; 15 days after birth about 20% of the nodes lack detectable sodium channel clusters. Sodium channel clustering and nerve conduction appear normal 60 and 75 days after birth, but subsequently a gradual disintegration of the nodal protein complexes is seen. About 70% of the mutant nodes present high-density sodium channel clustering at 120 days after birth, as opposed to nearly 100% for wild-type. Contrary to wild-type, in adult nodes of Ranvier the sodium channels are often clustered near the paranode border with an empty gap in the middle. At nodes of Ranvier, Schwann cell microvilli are sparse or absent and show defects in their orientation, resulting in various structural abnormalities at the node and the paranode border (PubMed:24719088).2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000001505830 – 1256Neuronal cell adhesion moleculeAdd BLAST1227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi62 ↔ 117PROSITE-ProRule annotation
Glycosylationi77N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi161 ↔ 212PROSITE-ProRule annotation
Glycosylationi217N-linked (GlcNAc...)Sequence analysis1
Glycosylationi239N-linked (GlcNAc...)Sequence analysis1
Glycosylationi245N-linked (GlcNAc...)Sequence analysis1
Glycosylationi270N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi286 ↔ 334PROSITE-ProRule annotation
Glycosylationi308N-linked (GlcNAc...)Sequence analysis1
Glycosylationi371N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi376 ↔ 426PROSITE-ProRule annotation
Glycosylationi427N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi470 ↔ 519PROSITE-ProRule annotation
Glycosylationi501N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi561 ↔ 610PROSITE-ProRule annotation
Glycosylationi613N-linked (GlcNAc...)Sequence analysis1
Glycosylationi710N-linked (GlcNAc...)Sequence analysis1
Glycosylationi796N-linked (GlcNAc...)Sequence analysis1
Glycosylationi852N-linked (GlcNAc...)Sequence analysis1
Glycosylationi987N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1003N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1013N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1067N-linked (GlcNAc...)Sequence analysis1
Modified residuei1173PhosphothreonineCombined sources1
Modified residuei1177PhosphotyrosineCombined sources1
Modified residuei1178PhosphoserineCombined sources1
Modified residuei1203PhosphoserineCombined sources1
Modified residuei1206PhosphoserineCombined sources1
Modified residuei1223PhosphoserineBy similarity1
Modified residuei1242PhosphoserineCombined sources1
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1247PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ810U4.
PeptideAtlasiQ810U4.
PRIDEiQ810U4.

PTM databases

iPTMnetiQ810U4.
PhosphoSitePlusiQ810U4.

Expressioni

Tissue specificityi

Detected in sciatic nerve (PubMed:14602817, PubMed:20188654, PubMed:24719088). Detected in brain, especially in the cerebellum Purkinje cell layer, inner granule cell layer and molecular layer (at protein level) (PubMed:11564762). Detected in neurons and Schwann cells (PubMed:20188654).4 Publications

Gene expression databases

BgeeiENSMUSG00000020598.
CleanExiMM_NRCAM.
GenevisibleiQ810U4. MM.

Interactioni

Subunit structurei

Constituent of a NFASC/NRCAM/ankyrin-G complex (Probable). Detected in a complex with CNTN1 and PTPRB (PubMed:11564762). Interacts with GLDN/gliomedin and MYOC (PubMed:16039564, PubMed:23897819).1 Publication3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg1Q811D06EBI-8321816,EBI-514290
Dlg4Q621082EBI-8321816,EBI-300895

GO - Molecular functioni

  • ankyrin binding Source: UniProtKB
  • protein binding involved in heterotypic cell-cell adhesion Source: MGI

Protein-protein interaction databases

BioGridi235320. 2 interactors.
IntActiQ810U4. 3 interactors.
MINTiMINT-3090404.
STRINGi10090.ENSMUSP00000020939.

Structurei

3D structure databases

ProteinModelPortaliQ810U4.
SMRiQ810U4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 128Ig-like C2-type 1Add BLAST89
Domaini135 – 229Ig-like C2-type 2Add BLAST95
Domaini261 – 350Ig-like C2-type 3Add BLAST90
Domaini355 – 442Ig-like C2-type 4Add BLAST88
Domaini448 – 535Ig-like C2-type 5Add BLAST88
Domaini539 – 626Ig-like C2-type 6Add BLAST88
Domaini643 – 738Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST96
Domaini740 – 837Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST98
Domaini842 – 944Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST103
Domaini948 – 1045Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98

Sequence similaritiesi

Contains 4 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3513. Eukaryota.
ENOG410XSVG. LUCA.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiQ810U4.
KOiK06756.
OMAiAEGDSGF.
OrthoDBiEOG091G00LY.
PhylomeDBiQ810U4.
TreeFamiTF351098.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 2 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 6 hits.
SM00408. IGc2. 6 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q810U4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY
60 70 80 90 100
IIDPRENIVI QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI
110 120 130 140 150
NIMSEGKAET YEGVYQCTAR NERGAAVSNN IVVRPSRSPL WTKERLEPIV
160 170 180 190 200
LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ RLPQSERVSQ GLNGDLYFSN
210 220 230 240 250
VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND TIAANLSDTE
260 270 280 290 300
FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK
310 320 330 340 350
EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT
360 370 380 390 400
VKAAPYWIVA PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD
410 420 430 440 450
DPSRKIDGDT IIFSNVQESS SAVYQCNASN KYGYLLANAF VNVLAEPPRI
460 470 480 490 500
LTSANTLYQV IANRPALLDC AFFGSPMPTI EWFKGTKGSA LHEDIYVLHD
510 520 530 540 550
NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT RIIKQPEYAV
560 570 580 590 600
VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV
610 620 630 640 650
KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT
660 670 680 690 700
NQLDKSVQLT WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT
710 720 730 740 750
AQLKLSPYVN YSFRVMAENS IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL
760 770 780 790 800
GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW RQKDGDDEWT SVVVANVSKY
810 820 830 840 850
IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM VAPGNVRVSV
860 870 880 890 900
VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF
910 920 930 940 950
QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS
960 970 980 990 1000
SLKIVNPTLD SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI
1010 1020 1030 1040 1050
PANKTRWTLK NLNFSTRYKF YFYAQTSVGP GSQITEEAIT TVDEAGIPPP
1060 1070 1080 1090 1100
DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP GTAYKVRVGA EGDSGFVSSE
1110 1120 1130 1140 1150
DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC FIRRNKGGKY
1160 1170 1180 1190 1200
PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK
1210 1220 1230 1240 1250
EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN

AMNSFV
Length:1,256
Mass (Da):138,522
Last modified:November 14, 2003 - v2
Checksum:iF3F698C2AF3FCFFA
GO
Isoform 2 (identifier: Q810U4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     629-638: Missing.
     1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK

Note: No experimental confirmation available.
Show »
Length:1,186
Mass (Da):131,274
Checksum:i959FBD8D4384F861
GO
Isoform 3 (identifier: Q810U4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: Y → YRSFE

Note: No experimental confirmation available.
Show »
Length:1,260
Mass (Da):139,041
Checksum:iD1CF15B186D22420
GO
Isoform 4 (identifier: Q810U4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     254-259: AKSSKE → GELQWL
     260-1256: Missing.

Note: No experimental confirmation available.
Show »
Length:259
Mass (Da):29,063
Checksum:iEB3687E24A1CABED
GO
Isoform 5 (identifier: Q810U4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → DPKLLHD
     235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
     255-1256: Missing.

Note: No experimental confirmation available.
Show »
Length:260
Mass (Da):28,964
Checksum:i1794BD3DC8E9A6E2
GO

Sequence cautioni

The sequence BAC65534 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD65848 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00892135D → DPKLLHD in isoform 5. 1 Publication1
Alternative sequenceiVSP_008922235 – 254VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_008923254 – 259AKSSKE → GELQWL in isoform 4. 1 Publication6
Alternative sequenceiVSP_008924255 – 1256Missing in isoform 5. 1 PublicationAdd BLAST1002
Alternative sequenceiVSP_008925260 – 1256Missing in isoform 4. 1 PublicationAdd BLAST997
Alternative sequenceiVSP_008926629 – 638Missing in isoform 2. 1 Publication10
Alternative sequenceiVSP_0089271045 – 1107AGIPP…FETGP → GKK in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0089301177Y → YRSFE in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
AK122252 mRNA. Translation: BAC65534.1. Different initiation.
AK039322 mRNA. Translation: BAC30318.1.
AK048567 mRNA. Translation: BAC33377.1.
AK045259 mRNA. Translation: BAC32284.1.
CCDSiCCDS49056.1. [Q810U4-1]
CCDS49057.1. [Q810U4-2]
RefSeqiNP_001139503.1. NM_001146031.1. [Q810U4-2]
NP_795904.3. NM_176930.4. [Q810U4-1]
UniGeneiMm.208439.

Genome annotation databases

EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
GeneIDi319504.
KEGGimmu:319504.
UCSCiuc007nls.2. mouse. [Q810U4-5]
uc007nlt.2. mouse. [Q810U4-2]
uc007nlu.2. mouse. [Q810U4-1]
uc007nlw.1. mouse. [Q810U4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
AK122252 mRNA. Translation: BAC65534.1. Different initiation.
AK039322 mRNA. Translation: BAC30318.1.
AK048567 mRNA. Translation: BAC33377.1.
AK045259 mRNA. Translation: BAC32284.1.
CCDSiCCDS49056.1. [Q810U4-1]
CCDS49057.1. [Q810U4-2]
RefSeqiNP_001139503.1. NM_001146031.1. [Q810U4-2]
NP_795904.3. NM_176930.4. [Q810U4-1]
UniGeneiMm.208439.

3D structure databases

ProteinModelPortaliQ810U4.
SMRiQ810U4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi235320. 2 interactors.
IntActiQ810U4. 3 interactors.
MINTiMINT-3090404.
STRINGi10090.ENSMUSP00000020939.

PTM databases

iPTMnetiQ810U4.
PhosphoSitePlusiQ810U4.

Proteomic databases

PaxDbiQ810U4.
PeptideAtlasiQ810U4.
PRIDEiQ810U4.

Protocols and materials databases

DNASUi319504.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
GeneIDi319504.
KEGGimmu:319504.
UCSCiuc007nls.2. mouse. [Q810U4-5]
uc007nlt.2. mouse. [Q810U4-2]
uc007nlu.2. mouse. [Q810U4-1]
uc007nlw.1. mouse. [Q810U4-4]

Organism-specific databases

CTDi4897.
MGIiMGI:104750. Nrcam.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3513. Eukaryota.
ENOG410XSVG. LUCA.
GeneTreeiENSGT00760000118840.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
InParanoidiQ810U4.
KOiK06756.
OMAiAEGDSGF.
OrthoDBiEOG091G00LY.
PhylomeDBiQ810U4.
TreeFamiTF351098.

Enzyme and pathway databases

ReactomeiR-MMU-447038. NrCAM interactions.
R-MMU-447043. Neurofascin interactions.

Miscellaneous databases

ChiTaRSiNrcam. mouse.
PROiQ810U4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020598.
CleanExiMM_NRCAM.
GenevisibleiQ810U4. MM.

Family and domain databases

CDDicd00063. FN3. 4 hits.
Gene3Di2.60.40.10. 11 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 2 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 6 hits.
SM00408. IGc2. 6 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 6 hits.
SSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNRCAM_MOUSE
AccessioniPrimary (citable) accession number: Q810U4
Secondary accession number(s): Q80U33
, Q8BLG8, Q8BX92, Q8BYJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: November 14, 2003
Last modified: November 30, 2016
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.