SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q810U4

- NRCAM_MOUSE

UniProt

Q810U4 - NRCAM_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuronal cell adhesion molecule

Gene
Nrcam, Kiaa0343
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.1 Publication

GO - Molecular functioni

  1. ankyrin binding Source: UniProtKB
  2. protein binding Source: UniProtKB
  3. protein binding involved in heterotypic cell-cell adhesion Source: MGI

GO - Biological processi

  1. angiogenesis Source: Ensembl
  2. axon guidance Source: UniProtKB
  3. central nervous system development Source: UniProtKB
  4. clustering of voltage-gated sodium channels Source: UniProtKB
  5. heterotypic cell-cell adhesion Source: GOC
  6. neuronal action potential propagation Source: MGI
  7. protein localization Source: MGI
  8. regulation of neuron projection development Source: MGI
  9. retinal ganglion cell axon guidance Source: MGI
  10. single organismal cell-cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal cell adhesion molecule
Short name:
Nr-CAM
Alternative name(s):
Neuronal surface protein Bravo
Short name:
mBravo
NgCAM-related cell adhesion molecule
Short name:
Ng-CAM-related
Gene namesi
Name:Nrcam
Synonyms:Kiaa0343
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 12

Organism-specific databases

MGIiMGI:104750. Nrcam.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 11191090Extracellular Reviewed predictionAdd
BLAST
Transmembranei1120 – 114223Helical; Reviewed predictionAdd
BLAST
Topological domaini1143 – 1256114Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. axon Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: MGI
  4. synapse Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929 Reviewed predictionAdd
BLAST
Chaini30 – 12561227Neuronal cell adhesion moleculePRO_0000015058Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi62 ↔ 117 Reviewed prediction
Glycosylationi77 – 771N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi161 ↔ 212 Reviewed prediction
Glycosylationi217 – 2171N-linked (GlcNAc...) Reviewed prediction
Glycosylationi239 – 2391N-linked (GlcNAc...) Reviewed prediction
Glycosylationi245 – 2451N-linked (GlcNAc...) Reviewed prediction
Glycosylationi270 – 2701N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi286 ↔ 334 Reviewed prediction
Glycosylationi308 – 3081N-linked (GlcNAc...) Reviewed prediction
Glycosylationi371 – 3711N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi376 ↔ 426 Reviewed prediction
Glycosylationi427 – 4271N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi470 ↔ 519 Reviewed prediction
Glycosylationi501 – 5011N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi561 ↔ 610 Reviewed prediction
Glycosylationi613 – 6131N-linked (GlcNAc...) Reviewed prediction
Glycosylationi710 – 7101N-linked (GlcNAc...) Reviewed prediction
Glycosylationi796 – 7961N-linked (GlcNAc...) Reviewed prediction
Glycosylationi852 – 8521N-linked (GlcNAc...) Reviewed prediction
Glycosylationi987 – 9871N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1003 – 10031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1013 – 10131N-linked (GlcNAc...) Reviewed prediction
Glycosylationi1067 – 10671N-linked (GlcNAc...) Reviewed prediction
Modified residuei1223 – 12231Phosphoserine By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ810U4.
PaxDbiQ810U4.
PRIDEiQ810U4.

PTM databases

PhosphoSiteiQ810U4.

Expressioni

Gene expression databases

ArrayExpressiQ810U4.
BgeeiQ810U4.
CleanExiMM_NRCAM.
GenevestigatoriQ810U4.

Interactioni

Subunit structurei

Probable constituent of a neurofascin/NRCAM/ankyrin-G complex By similarity. Interacts with GLDN/gliomedin and MYOC.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg1Q811D06EBI-8321816,EBI-514290
Dlg4Q621082EBI-8321816,EBI-300895

Protein-protein interaction databases

BioGridi235320. 2 interactions.
IntActiQ810U4. 3 interactions.
MINTiMINT-3090404.

Structurei

3D structure databases

ProteinModelPortaliQ810U4.
SMRiQ810U4. Positions 36-827, 836-1048.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini40 – 12889Ig-like C2-type 1Add
BLAST
Domaini135 – 22995Ig-like C2-type 2Add
BLAST
Domaini261 – 35090Ig-like C2-type 3Add
BLAST
Domaini355 – 44288Ig-like C2-type 4Add
BLAST
Domaini448 – 53588Ig-like C2-type 5Add
BLAST
Domaini539 – 62688Ig-like C2-type 6Add
BLAST
Domaini643 – 73896Fibronectin type-III 1Add
BLAST
Domaini740 – 83798Fibronectin type-III 2Add
BLAST
Domaini842 – 944103Fibronectin type-III 3Add
BLAST
Domaini948 – 104598Fibronectin type-III 4Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG293951.
GeneTreeiENSGT00720000108572.
HOGENOMiHOG000231380.
HOVERGENiHBG000144.
KOiK06756.
OMAiYANISWE.
OrthoDBiEOG7R56RM.
PhylomeDBiQ810U4.
TreeFamiTF351098.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view]
PfamiPF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 3 hits.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q810U4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQLKIMPKKK HLSAGGVPLI LFLCQMISAL DVPLDLVQPP TITQQSPKDY     50
IIDPRENIVI QCEAKGKPPP SFSWTRNGTH FDIDKDPLVT MKPGSGTLVI 100
NIMSEGKAET YEGVYQCTAR NERGAAVSNN IVVRPSRSPL WTKERLEPIV 150
LQNGQSLVLP CRPPIGLPPA IIFWMDNSFQ RLPQSERVSQ GLNGDLYFSN 200
VLPEDTREDY ICYARFNHTQ TIQQKQPISL KVISVDELND TIAANLSDTE 250
FYGAKSSKER PPTFLTPEGN ESHKEELRGN VLSLECIAEG LPTPIIYWIK 300
EDGMLPANRT FYRNFKKTLQ ITHVSEADSG NYQCIAKNAL GAVHHTISVT 350
VKAAPYWIVA PQNLVLSPGE NGTLICRANG NPKPRISWLT NGVPIEIALD 400
DPSRKIDGDT IIFSNVQESS SAVYQCNASN KYGYLLANAF VNVLAEPPRI 450
LTSANTLYQV IANRPALLDC AFFGSPMPTI EWFKGTKGSA LHEDIYVLHD 500
NGTLEIPVAQ KDSTGTYTCV ARNKLGMAKN EVHLEIKDPT RIIKQPEYAV 550
VQRGSKVSFE CRVKHDHTLI PTIMWLKDNG ELPNDERFST DKDHLVVSDV 600
KDDDGGTYTC TANTTLDSAS ASAVLRVVAP TPTPAPIYDV PNPPFDLELT 650
NQLDKSVQLT WTPGDDNNSP ITKFIIEYED AMHDAGLWRH QAEVSGTQTT 700
AQLKLSPYVN YSFRVMAENS IGRSMPSEAS EQYLTKAAEP DQNPMAVEGL 750
GTEPDNLVIT WKPLNGFQSN GPGLQYKVSW RQKDGDDEWT SVVVANVSKY 800
IVSGTPTFVP YLIKVQALND VGFAPEPAAV MGHSGEDLPM VAPGNVRVSV 850
VNSTLAEVHW DPVPPKSVRG HLQGYRIYYW KTQSSSKRNR RHIEKKILTF 900
QGTKTHGMLP GLQPYSHYAL NVRVVNGKGE GPASTDRGFH TPEGVPSAPS 950
SLKIVNPTLD SLTLEWDPPS HPNGILTEYI LQYQPINSTH ELGPLVDLKI 1000
PANKTRWTLK NLNFSTRYKF YFYAQTSVGP GSQITEEAIT TVDEAGIPPP 1050
DVGAGKGKEE WRKEIVNGSR SFFGLKGLMP GTAYKVRVGA EGDSGFVSSE 1100
DVFETGPAMA SRQVDIATQG WFIGLMCAVA LLILILLIVC FIRRNKGGKY 1150
PVKEKEDAHA DPEIQPMKED DGTFGEYSDA EDHKPLKKGS RTPSDRTVKK 1200
EDSDDSLVDY GEGVNGQFNE DGSFIGQYSG KKEKEPAEGN ESSEAPSPVN 1250
AMNSFV 1256
Length:1,256
Mass (Da):138,522
Last modified:November 14, 2003 - v2
Checksum:iF3F698C2AF3FCFFA
GO
Isoform 2 (identifier: Q810U4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     629-638: Missing.
     1045-1107: AGIPPPDVGAGKGKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGP → GKK

Note: No experimental confirmation available.

Show »
Length:1,186
Mass (Da):131,274
Checksum:i959FBD8D4384F861
GO
Isoform 3 (identifier: Q810U4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: Y → YRSFE

Note: No experimental confirmation available.

Show »
Length:1,260
Mass (Da):139,041
Checksum:iD1CF15B186D22420
GO
Isoform 4 (identifier: Q810U4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     254-259: AKSSKE → GELQWL
     260-1256: Missing.

Note: No experimental confirmation available.

Show »
Length:259
Mass (Da):29,063
Checksum:iEB3687E24A1CABED
GO
Isoform 5 (identifier: Q810U4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → DPKLLHD
     235-254: VDELNDTIAANLSDTEFYGA → GKSSASGLSFNGVYLCGSNY
     255-1256: Missing.

Note: No experimental confirmation available.

Show »
Length:260
Mass (Da):28,964
Checksum:i1794BD3DC8E9A6E2
GO

Sequence cautioni

The sequence BAC65534.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAD65848.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei35 – 351D → DPKLLHD in isoform 5. VSP_008921
Alternative sequencei235 – 25420VDELN…EFYGA → GKSSASGLSFNGVYLCGSNY in isoform 5. VSP_008922Add
BLAST
Alternative sequencei254 – 2596AKSSKE → GELQWL in isoform 4. VSP_008923
Alternative sequencei255 – 12561002Missing in isoform 5. VSP_008924Add
BLAST
Alternative sequencei260 – 1256997Missing in isoform 4. VSP_008925Add
BLAST
Alternative sequencei629 – 63810Missing in isoform 2. VSP_008926
Alternative sequencei1045 – 110763AGIPP…FETGP → GKK in isoform 2. VSP_008927Add
BLAST
Alternative sequencei1177 – 11771Y → YRSFE in isoform 3. VSP_008930

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ543321 mRNA. Translation: CAD65848.1. Different initiation.
AK122252 mRNA. Translation: BAC65534.1. Different initiation.
AK039322 mRNA. Translation: BAC30318.1.
AK048567 mRNA. Translation: BAC33377.1.
AK045259 mRNA. Translation: BAC32284.1.
CCDSiCCDS49056.1. [Q810U4-1]
CCDS49057.1. [Q810U4-2]
RefSeqiNP_001139503.1. NM_001146031.1. [Q810U4-2]
NP_795904.3. NM_176930.4. [Q810U4-1]
UniGeneiMm.208439.

Genome annotation databases

EnsembliENSMUST00000020939; ENSMUSP00000020939; ENSMUSG00000020598. [Q810U4-1]
ENSMUST00000110748; ENSMUSP00000106376; ENSMUSG00000020598. [Q810U4-2]
GeneIDi319504.
KEGGimmu:319504.
UCSCiuc007nls.2. mouse. [Q810U4-5]
uc007nlt.2. mouse. [Q810U4-2]
uc007nlu.2. mouse. [Q810U4-1]
uc007nlw.1. mouse. [Q810U4-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ543321 mRNA. Translation: CAD65848.1 . Different initiation.
AK122252 mRNA. Translation: BAC65534.1 . Different initiation.
AK039322 mRNA. Translation: BAC30318.1 .
AK048567 mRNA. Translation: BAC33377.1 .
AK045259 mRNA. Translation: BAC32284.1 .
CCDSi CCDS49056.1. [Q810U4-1 ]
CCDS49057.1. [Q810U4-2 ]
RefSeqi NP_001139503.1. NM_001146031.1. [Q810U4-2 ]
NP_795904.3. NM_176930.4. [Q810U4-1 ]
UniGenei Mm.208439.

3D structure databases

ProteinModelPortali Q810U4.
SMRi Q810U4. Positions 36-827, 836-1048.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 235320. 2 interactions.
IntActi Q810U4. 3 interactions.
MINTi MINT-3090404.

PTM databases

PhosphoSitei Q810U4.

Proteomic databases

MaxQBi Q810U4.
PaxDbi Q810U4.
PRIDEi Q810U4.

Protocols and materials databases

DNASUi 319504.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000020939 ; ENSMUSP00000020939 ; ENSMUSG00000020598 . [Q810U4-1 ]
ENSMUST00000110748 ; ENSMUSP00000106376 ; ENSMUSG00000020598 . [Q810U4-2 ]
GeneIDi 319504.
KEGGi mmu:319504.
UCSCi uc007nls.2. mouse. [Q810U4-5 ]
uc007nlt.2. mouse. [Q810U4-2 ]
uc007nlu.2. mouse. [Q810U4-1 ]
uc007nlw.1. mouse. [Q810U4-4 ]

Organism-specific databases

CTDi 4897.
MGIi MGI:104750. Nrcam.
Rougei Search...

Phylogenomic databases

eggNOGi NOG293951.
GeneTreei ENSGT00720000108572.
HOGENOMi HOG000231380.
HOVERGENi HBG000144.
KOi K06756.
OMAi YANISWE.
OrthoDBi EOG7R56RM.
PhylomeDBi Q810U4.
TreeFami TF351098.

Miscellaneous databases

ChiTaRSi NRCAM. mouse.
NextBioi 394866.
PROi Q810U4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q810U4.
Bgeei Q810U4.
CleanExi MM_NRCAM.
Genevestigatori Q810U4.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR026966. Neurofascin/L1/NrCAM_C.
[Graphical view ]
Pfami PF13882. Bravo_FIGEY. 1 hit.
PF00041. fn3. 4 hits.
PF07679. I-set. 3 hits.
[Graphical view ]
SMARTi SM00060. FN3. 4 hits.
SM00409. IG. 1 hit.
SM00408. IGc2. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
PROSITEi PS50853. FN3. 4 hits.
PS50835. IG_LIKE. 6 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression patterns of L1-family cell recognition molecules L1, CHL1, NrCAM, and neurofascin in the mouse brain."
    Dirks P., Montag-Sallaz M., Montag D.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss Webster.
    Tissue: Brain.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1094-1256 (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Spinal cord.
  4. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 432-449 AND 705-723, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.
  5. "Gliomedin mediates Schwann cell-axon interaction and the molecular assembly of the nodes of Ranvier."
    Eshed Y., Feinberg K., Poliak S., Sabanay H., Sarig-Nadir O., Spiegel I., Bermingham J.R. Jr., Peles E.
    Neuron 47:215-229(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH GLDN.
  6. "Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling."
    Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.
    J. Biol. Chem. 288:26357-26371(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MYOC.

Entry informationi

Entry nameiNRCAM_MOUSE
AccessioniPrimary (citable) accession number: Q810U4
Secondary accession number(s): Q80U33
, Q8BLG8, Q8BX92, Q8BYJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: November 14, 2003
Last modified: September 3, 2014
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi