Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SLIT and NTRK-like protein 5

Gene

Slitrk5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Suppresses neurite outgrowth.1 Publication

GO - Biological processi

  • adult behavior Source: MGI
  • axonogenesis Source: MGI
  • cardiovascular system development Source: MGI
  • chemical synaptic transmission Source: MGI
  • dendrite morphogenesis Source: MGI
  • grooming behavior Source: MGI
  • positive regulation of synapse assembly Source: MGI
  • response to xenobiotic stimulus Source: MGI
  • skin development Source: MGI
  • striatum development Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
SLIT and NTRK-like protein 5
Gene namesi
Name:Slitrk5
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2679448. Slitrk5.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini41 – 664ExtracellularSequence analysisAdd BLAST624
Transmembranei665 – 685HelicalSequence analysisAdd BLAST21
Topological domaini686 – 957CytoplasmicSequence analysisAdd BLAST272

GO - Cellular componenti

  • integral component of membrane Source: MGI
  • receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 40Sequence analysisAdd BLAST40
ChainiPRO_000003268241 – 957SLIT and NTRK-like protein 5Sequence analysisAdd BLAST917

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi103N-linked (GlcNAc...)Sequence analysis1
Glycosylationi644N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ810B7.
PRIDEiQ810B7.

PTM databases

iPTMnetiQ810B7.
PhosphoSitePlusiQ810B7.

Expressioni

Tissue specificityi

In the adult, significant expression is detected only in the brain. In the embryo, expressed in the subventricular zone, cortical plate, pyramidal layer of hippocampus, thalamus and hypothalamus.1 Publication

Gene expression databases

BgeeiENSMUSG00000033214.
CleanExiMM_SLITRK5.
GenevisibleiQ810B7. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041499.

Structurei

3D structure databases

ProteinModelPortaliQ810B7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati82 – 103LRR 1Add BLAST22
Repeati106 – 127LRR 2Add BLAST22
Repeati130 – 151LRR 3Add BLAST22
Repeati154 – 175LRR 4Add BLAST22
Repeati178 – 199LRR 5Add BLAST22
Repeati201 – 222LRR 6Add BLAST22
Domaini235 – 286LRRCT 1Add BLAST52
Domaini365 – 407LRRNTAdd BLAST43
Repeati410 – 431LRR 7Add BLAST22
Repeati434 – 455LRR 8Add BLAST22
Repeati458 – 479LRR 9Add BLAST22
Repeati482 – 503LRR 10Add BLAST22
Repeati506 – 527LRR 11Add BLAST22
Repeati529 – 550LRR 12Add BLAST22
Domaini563 – 614LRRCT 2Add BLAST52

Sequence similaritiesi

Belongs to the SLITRK family.Curated
Contains 12 LRR (leucine-rich) repeats.Curated
Contains 2 LRRCT domains.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGN5. Eukaryota.
ENOG4111D19. LUCA.
GeneTreeiENSGT00790000122963.
HOGENOMiHOG000290667.
HOVERGENiHBG056407.
InParanoidiQ810B7.
OMAiVICKAPK.
OrthoDBiEOG091G02AI.
PhylomeDBiQ810B7.
TreeFamiTF326378.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00369. LRR_TYP. 10 hits.
SM00082. LRRCT. 2 hits.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 2 hits.
PROSITEiPS51450. LRR. 11 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q810B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHVCCPPVTL EQDLHRKMHS WMLQTLAFAV TSLVLSCAET IDYYGEICDN
60 70 80 90 100
ACPCEEKDGI LTVSCENRGI ISLSEISPPR FPIYHLLLSG NLLSRLYPNE
110 120 130 140 150
FVNYTGASIL HLGSNVIQDI ETGAFHGLRG LRRLHLNNNK LELLRDDTFL
160 170 180 190 200
GLENLEYLQV DYNYISVIEP NAFGKLHMLQ VLILNDNLLS GLPNNLFRFV
210 220 230 240 250
PLTHLDLRGN RLKLLPYVGL LQHMDKVVEL QLEENPWNCS CELISLKDWL
260 270 280 290 300
DSISYSALVG DVVCETPFRL HGRDLDEVSK QELCPRKLIS DYEMRPQTPL
310 320 330 340 350
STTGYLHTTP ASVNSVATSS SAVYKPPLKP PKGTRQPNKP RVRPTSRQPS
360 370 380 390 400
KDLGYSNYGP SIAYQTKSPV PLECPTACTC NLQISDLGLN VNCQERKIES
410 420 430 440 450
IAELQPKPYN PKKMYLTENY ITVVRRTDFL EATGLDLLHL GNNRISMIQD
460 470 480 490 500
RAFGDLGNLR RLYLNGNRIE RLSPELFYGL QSLQYLFLQY NLIREIQAGT
510 520 530 540 550
FDPVPNLQLL FLNNNQLQAM PSGVFSGLTL LRLNLRGNSF TSLPVSGVLD
560 570 580 590 600
QLTSLIQIDL HDNPWDCTCD VVGMKLWIEQ LKVGVLVDEV ICKAPKKFAE
610 620 630 640 650
TYMRSIKSEL LCPDYSDVVV STPTPSSIQV PSRTNAATPA VRLNSTGTPA
660 670 680 690 700
GLGAGTGASS VPLSVLILSL LLVFIMSVFV AAGLFVLVMK RRKKNQSDHT
710 720 730 740 750
STNNSDVSSF NMQYSVYGGG GGGGGGHPHA HVHHRGPALP KVKTPAGHVY
760 770 780 790 800
EYIPHPLGHM CKNPIYRSRE GNSVEDYKDL HELKVTYSSN HHLQQQPPPP
810 820 830 840 850
PQQPQQQPPP QMQMQPGEEE RRESHHLRSP AYSVSTIEPR EDLLSPVQDA
860 870 880 890 900
DRFYRGILEP DKHCSTTPAG SSLPEYPKFP CSPAAYTFSP NYDLRRPHQY
910 920 930 940 950
LHPGAGESRL REPVLYSPPG AVFVEPNRNE YLELKAKLNV EPDYLEVLEK

QTTFSQF
Length:957
Mass (Da):107,165
Last modified:June 1, 2003 - v1
Checksum:i0CB89BD7FE2D18AF
GO
Isoform 2Curated (identifier: Q810B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     706-722: DVSSFNMQYSVYGGGGG → AATAPAAAPSADADAAW
     726-755: GHPHAHVHHRGPALPKVKTPAGHVYEYIPH → EAGKPPFEEPRLQRQHHRAPRGPTVAGAGR
     756-957: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:755
Mass (Da):83,704
Checksum:iA26B07F14E900127
GO

Sequence cautioni

The sequence AK011457 differs from that shown. Reason: Frameshift at position 836.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti153E → D in AAH65107 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_050708706 – 722DVSSF…GGGGG → AATAPAAAPSADADAAW in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_050709726 – 755GHPHA…EYIPH → EAGKPPFEEPRLQRQHHRAP RGPTVAGAGR in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_050710756 – 957Missing in isoform 2. 1 PublicationAdd BLAST202

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097574 Genomic DNA. Translation: BAC67208.1.
BC065107 mRNA. Translation: AAH65107.1.
AK011457 mRNA. No translation available.
CCDSiCCDS27328.1. [Q810B7-1]
RefSeqiNP_942565.1. NM_198865.1. [Q810B7-1]
XP_006519705.1. XM_006519642.3. [Q810B7-1]
XP_006519706.1. XM_006519643.3. [Q810B7-1]
UniGeneiMm.235097.
Mm.417152.

Genome annotation databases

EnsembliENSMUST00000042767; ENSMUSP00000041499; ENSMUSG00000033214. [Q810B7-1]
GeneIDi75409.
KEGGimmu:75409.
UCSCiuc011zpr.1. mouse. [Q810B7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB097574 Genomic DNA. Translation: BAC67208.1.
BC065107 mRNA. Translation: AAH65107.1.
AK011457 mRNA. No translation available.
CCDSiCCDS27328.1. [Q810B7-1]
RefSeqiNP_942565.1. NM_198865.1. [Q810B7-1]
XP_006519705.1. XM_006519642.3. [Q810B7-1]
XP_006519706.1. XM_006519643.3. [Q810B7-1]
UniGeneiMm.235097.
Mm.417152.

3D structure databases

ProteinModelPortaliQ810B7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000041499.

PTM databases

iPTMnetiQ810B7.
PhosphoSitePlusiQ810B7.

Proteomic databases

PaxDbiQ810B7.
PRIDEiQ810B7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042767; ENSMUSP00000041499; ENSMUSG00000033214. [Q810B7-1]
GeneIDi75409.
KEGGimmu:75409.
UCSCiuc011zpr.1. mouse. [Q810B7-1]

Organism-specific databases

CTDi26050.
MGIiMGI:2679448. Slitrk5.

Phylogenomic databases

eggNOGiENOG410IGN5. Eukaryota.
ENOG4111D19. LUCA.
GeneTreeiENSGT00790000122963.
HOGENOMiHOG000290667.
HOVERGENiHBG056407.
InParanoidiQ810B7.
OMAiVICKAPK.
OrthoDBiEOG091G02AI.
PhylomeDBiQ810B7.
TreeFamiTF326378.

Miscellaneous databases

ChiTaRSiSlitrk5. mouse.
PROiQ810B7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000033214.
CleanExiMM_SLITRK5.
GenevisibleiQ810B7. MM.

Family and domain databases

Gene3Di3.80.10.10. 3 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00369. LRR_TYP. 10 hits.
SM00082. LRRCT. 2 hits.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 2 hits.
PROSITEiPS51450. LRR. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSLIK5_MOUSE
AccessioniPrimary (citable) accession number: Q810B7
Secondary accession number(s): Q9CT21
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.