Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endothelin-converting enzyme 2

Gene

Ece2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Converts big endothelin-1 to endothelin-1. Also involved in the processing of various neuroendocrine peptides, including neurotensin, angiotensin I, substance P, proenkephalin-derived peptides, and prodynorphin-derived peptides. May limit beta-amyloid peptide accumulation in brain. May also have methyltransferase activity.1 Publication

Catalytic activityi

Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei30S-adenosyl-L-homocysteineBy similarity1
Binding sitei41S-adenosyl-L-homocysteine; via amide nitrogenBy similarity1
Binding sitei66S-adenosyl-L-homocysteine; via carbonyl oxygenBy similarity1
Binding sitei130S-adenosyl-L-homocysteineBy similarity1
Metal bindingi718Zinc; catalyticBy similarity1
Active sitei719By similarity1
Metal bindingi722Zinc; catalyticBy similarity1
Metal bindingi778Zinc; catalyticBy similarity1
Active sitei782Proton donorBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Methyltransferase, Protease, Transferase

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM13.003.

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelin-converting enzyme 2
Short name:
ECE-2
Including the following 2 domains:
Methyltransferase-like region (EC:2.1.1.-)
Endothelin-converting enzyme 2 region (EC:3.4.24.71)
Gene namesi
Name:Ece2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:1101356. Ece2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 178CytoplasmicSequence analysisAdd BLAST178
Transmembranei179 – 199HelicalSequence analysisAdd BLAST21
Topological domaini200 – 881LumenalSequence analysisAdd BLAST682

GO - Cellular componenti

  • cytoplasmic vesicle membrane Source: UniProtKB
  • Golgi membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • trans-Golgi network Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Disruption phenotypei

Mice are fertile and healthy, and do not display any abnormality in terms of growth or aging. However, they have elevated concentrations of beta-amyloid-40 and beta-amyloid-42 in brain.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003107601 – 881Endothelin-converting enzyme 2Add BLAST881

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei39PhosphotyrosineBy similarity1
Glycosylationi322N-linked (GlcNAc...)Sequence analysis1
Glycosylationi363N-linked (GlcNAc...)Sequence analysis1
Glycosylationi382N-linked (GlcNAc...)Sequence analysis1
Glycosylationi427N-linked (GlcNAc...)Sequence analysis1
Isoform 2 (identifier: Q80Z60-2)
Modified residuei174PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ80Z60.
PeptideAtlasiQ80Z60.
PRIDEiQ80Z60.

PTM databases

iPTMnetiQ80Z60.
PhosphoSitePlusiQ80Z60.

Expressioni

Tissue specificityi

Expressed at high levels in central nervous system. Expressed in adrenal glands, ovary and uterus, and at low levels in heart.1 Publication

Developmental stagei

Weakly expressed in mesenchyme and parts of neural tube at E10.5. At E13.5, expressed in anterior part of neural tube, dorsal root ganglia, bilateral sympathetic trunk and heart.1 Publication

Gene expression databases

BgeeiENSMUSG00000022842.
CleanExiMM_ECE2.
ExpressionAtlasiQ80Z60. baseline and differential.
GenevisibleiQ80Z60. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000113475.

Structurei

3D structure databases

ProteinModelPortaliQ80Z60.
SMRiQ80Z60.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 160Methyltransferase-like regionAdd BLAST160
Regioni88 – 89S-adenosyl-L-homocysteine bindingBy similarity2
Regioni113 – 114S-adenosyl-L-homocysteine bindingBy similarity2
Regioni200 – 881Endothelin-converting enzyme 2 regionAdd BLAST682

Sequence similaritiesi

In the N-terminal section; belongs to the methyltransferase superfamily.Curated
In the C-terminal section; belongs to the peptidase M13 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2352. Eukaryota.
KOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiQ80Z60.
KOiK01415.
PhylomeDBiQ80Z60.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
3.40.50.150. 1 hit.
InterProiIPR029733. ECE2.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF127. PTHR11733:SF127. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80Z60-1) [UniParc]FASTAAdd to basket
Also known as: ECE-2a-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPRTPVSP PELPEKNFQY RQVQYWDQRY KDAADSGPYE WFGDFASFRA
60 70 80 90 100
LLEPELCPED RILVLGCGNS ALSYELFLGG FPNVTSVDYS PVVVAAMQVR
110 120 130 140 150
YAHVPSLRWE TMDVRALDFP SGSFDVVLEK GTLDAMLAGE PDPWNVSSEG
160 170 180 190 200
VHTVDQVLSE VGFQKRTRQL FGSHTQLELV LAGLILVLAA LLLGCLVALW
210 220 230 240 250
VHRDPAHSTC VTEACIRVAG KILESLDRGV SPCQDFYQFS CGGWIRRNPL
260 270 280 290 300
PNGRSRWNTF NSLWDQNQAI LKHLLENTTF NSSSEAERKT RSFYLSCLQS
310 320 330 340 350
ERIEKLGAKP LRDLIDKIGG WNITGPWDED SFMDVLKAVA GTYRATPFFT
360 370 380 390 400
VYVSADSKRS YSNITQVDQS GLFLPSRDYY LNRTANEKVL TAYLDYMVEL
410 420 430 440 450
GVLLGGQPTS TREQMQQVLE LEIQLANITV PQDQRRDEEK IYHKMSISEL
460 470 480 490 500
QALAPAVDWL EFLSFLLSPL ELGDSEPVVV YGMSYLQQVS ELINRTEPSI
510 520 530 540 550
LNNYLIWNLV QKTTSSLDQR FETAQEKLLE TLYGTKKSCT PRWQTCISNT
560 570 580 590 600
DDALGFALGS LFVKATFDRQ SKEIAEGMIN EIRSAFEETL GDLVWMDEKT
610 620 630 640 650
RLAAKEKADA IYDMIGFPDF ILEPKELDDV YYGYEVSEDS FFQNMLNLYN
660 670 680 690 700
FSAKVMADQL RKPPSRDQWS MTPQTVNAYY LPTKNEIVFP AGILQPPFYA
710 720 730 740 750
HNHPKALNFG GIGVVMDHEL THAFDDQGRE YDKEGNLRPW WQNESLTAFQ
760 770 780 790 800
NHTACMEEQY SQYQVNGERL NGLQTLGENI ADNGGLKAAY NAYKAWLRKH
810 820 830 840 850
GEEQPLPAVG LTNHQLFFVG FAQVWCSVRT PESSHEGLVT DPHSPARFRV
860 870 880
LGTLSNSRDF LRHFGCPVGS PMNPGQLCEV W
Length:881
Mass (Da):99,707
Last modified:November 13, 2007 - v2
Checksum:i79A3F7BF128F8BAA
GO
Isoform 2 (identifier: Q80Z60-2) [UniParc]FASTAAdd to basket
Also known as: ECE-2a-2

The sequence of this isoform differs from the canonical sequence as follows:
     159-159: S → SEMVEYKRAKLRDEESPEITVEGRATRDSL

Show »
Length:910
Mass (Da):103,097
Checksum:iF5D1C5680EEA575F
GO
Isoform 3 (identifier: Q80Z60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-260: VGFQKRTRQL...PNGRSRWNTF → VSRLLVPGGR...NEDFLSAIQL
     261-881: Missing.

Show »
Length:255
Mass (Da):28,531
Checksum:i250B2EF4520D7E47
GO

Sequence cautioni

The sequence AAO72356 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAO72357 differs from that shown. Reason: Erroneous initiation.Curated
Isoform 3 : The sequence BAB25257 differs from that shown. Reason: Frameshift at position 226.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti160E → V in BAB25257 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_029335159S → SEMVEYKRAKLRDEESPEIT VEGRATRDSL in isoform 2. 1 Publication1
Alternative sequenceiVSP_029336161 – 260VGFQK…RWNTF → VSRLLVPGGRFISMTSAGPH FRIRHYAQSRYDWSLRHTTY SSGFHFHFYIMHKGRALSVS QLALGAQILSSPSPPASPCF LQDSDNEDFLSAIQL in isoform 3. 2 PublicationsAdd BLAST100
Alternative sequenceiVSP_029339261 – 881Missing in isoform 3. 2 PublicationsAdd BLAST621

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007407 mRNA. Translation: BAB25019.1.
AK007791 mRNA. Translation: BAB25257.1. Frameshift.
BC115541 mRNA. Translation: AAI15542.1.
AF489569 mRNA. Translation: AAO72356.1. Different initiation.
AF489570 mRNA. Translation: AAO72357.1. Different initiation.
CCDSiCCDS37290.1. [Q80Z60-3]
CCDS49793.1. [Q80Z60-2]
CCDS49794.1. [Q80Z60-1]
RefSeqiNP_079738.2. NM_025462.2. [Q80Z60-3]
NP_808809.1. NM_177940.1.
NP_808810.1. NM_177941.1.
UniGeneiMm.263319.

Genome annotation databases

EnsembliENSMUST00000115522; ENSMUSP00000111184; ENSMUSG00000022842. [Q80Z60-3]
GeneIDi107522.
KEGGimmu:107522.
UCSCiuc007yqh.1. mouse. [Q80Z60-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007407 mRNA. Translation: BAB25019.1.
AK007791 mRNA. Translation: BAB25257.1. Frameshift.
BC115541 mRNA. Translation: AAI15542.1.
AF489569 mRNA. Translation: AAO72356.1. Different initiation.
AF489570 mRNA. Translation: AAO72357.1. Different initiation.
CCDSiCCDS37290.1. [Q80Z60-3]
CCDS49793.1. [Q80Z60-2]
CCDS49794.1. [Q80Z60-1]
RefSeqiNP_079738.2. NM_025462.2. [Q80Z60-3]
NP_808809.1. NM_177940.1.
NP_808810.1. NM_177941.1.
UniGeneiMm.263319.

3D structure databases

ProteinModelPortaliQ80Z60.
SMRiQ80Z60.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000113475.

Protein family/group databases

MEROPSiM13.003.

PTM databases

iPTMnetiQ80Z60.
PhosphoSitePlusiQ80Z60.

Proteomic databases

PaxDbiQ80Z60.
PeptideAtlasiQ80Z60.
PRIDEiQ80Z60.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000115522; ENSMUSP00000111184; ENSMUSG00000022842. [Q80Z60-3]
GeneIDi107522.
KEGGimmu:107522.
UCSCiuc007yqh.1. mouse. [Q80Z60-3]

Organism-specific databases

CTDi9718.
MGIiMGI:1101356. Ece2.

Phylogenomic databases

eggNOGiKOG2352. Eukaryota.
KOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiQ80Z60.
KOiK01415.
PhylomeDBiQ80Z60.

Miscellaneous databases

PROiQ80Z60.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022842.
CleanExiMM_ECE2.
ExpressionAtlasiQ80Z60. baseline and differential.
GenevisibleiQ80Z60. MM.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
3.40.50.150. 1 hit.
InterProiIPR029733. ECE2.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF127. PTHR11733:SF127. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
SUPFAMiSSF53335. SSF53335. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiECE2_MOUSE
AccessioniPrimary (citable) accession number: Q80Z60
Secondary accession number(s): Q14BY3
, Q80Z59, Q9D8Q9, Q9D928
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 2, 2016
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Multifunctional enzyme, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.