Q80Y61 (BI2L2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 Short name=BAI1-associated protein 2-like protein 2 Alternative name(s): Planar intestinal- and kidney-specific BAR domain protein Short name=Pinkbar | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 522 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Phosphoinositides-binding protein that induces the formation of planar or gently curved membrane structures. Binds to phosphoinositides, including to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) headgroups. There seems to be no clear preference for a specific phosphoinositide. Ref.5 |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. Cell junction By similarity. Cytoplasmic vesicle membrane By similarity. Note: Localizes to RAB13-positive vesicles and to the plasma membrane at intercellular contacts By similarity. |
| Tissue specificity | Expressed in the epithelial layer of the intestine and in the kidney. Ref.5 |
| Domain | The IMD domain consisting of an antiparallel dimer of three-helix bundles, featuring on one side a positively charged. The N-terminal alpha-helix inserts into the lipid bilayer. Also forms homodimers and homooligomers. The residue Trp-141 is essential for oligomer formation. |
| Sequence similarities | Contains 1 IMD (IRSp53/MIM homology) domain. Contains 1 SH3 domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q80Y61-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q80Y61-2) The sequence of this isoform differs from the canonical sequence as follows: 205-238: ARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPA → VSRAGESKPRPPGAVVRLRRTQEQERSFLPLCFL 239-522: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 522 | 522 | Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 | PRO_0000256131 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 1 – 239 | 239 | IMD | |||||||||||||||||
| Domain | 324 – 387 | 64 | SH3 | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 205 – 238 | 34 | ARGML…LLGPA → VSRAGESKPRPPGAVVRLRR TQEQERSFLPLCFL in isoform 2. | VSP_021325 | ||||||||||||||||
| Alternative sequence | 239 – 522 | 284 | Missing in isoform 2. | VSP_021326 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Mutagenesis | 109 | 1 | K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-116. Ref.5 | |||||||||||||||||
| Mutagenesis | 116 | 1 | K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-109. Ref.5 | |||||||||||||||||
| Mutagenesis | 124 | 1 | I → S: Partially impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering. Ref.5 | |||||||||||||||||
| Mutagenesis | 127 | 1 | R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-135. Ref.5 | |||||||||||||||||
| Mutagenesis | 135 | 1 | K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-127. Ref.5 | |||||||||||||||||
| Mutagenesis | 141 | 1 | W → S: Deficient in oligomerization (dimerization maintained). Inefficient formation of planar membrane structures. No effect on lipid-binding. Ref.5 | |||||||||||||||||
| Mutagenesis | 145 | 1 | R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-146 and A-147. Ref.5 | |||||||||||||||||
| Mutagenesis | 146 | 1 | K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-147. Ref.5 | |||||||||||||||||
| Mutagenesis | 147 | 1 | R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-146. Ref.5 | |||||||||||||||||
| Mutagenesis | 149 | 1 | K → A: No effect on lipid-binding; when associated with A-152 and A-155. Ref.5 | |||||||||||||||||
| Mutagenesis | 152 | 1 | R → A: No effect on lipid-binding; when associated with A-149 and A-155. Ref.5 | |||||||||||||||||
| Mutagenesis | 155 | 1 | K → A: No effect on lipid-binding; when associated with A-149 and A-152. Ref.5 | |||||||||||||||||
| Mutagenesis | 214 | 1 | L → S: No effect on lipid-binding. Ref.5 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Helix | 3 – 21 | 19 | ||||||||||||||||||
| Helix | 23 – 64 | 42 | ||||||||||||||||||
| Beta strand | 65 – 67 | 3 | ||||||||||||||||||
| Helix | 69 – 99 | 31 | ||||||||||||||||||
| Helix | 101 – 145 | 45 | ||||||||||||||||||
| Helix | 151 – 215 | 65 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Spleen. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Colon. |
| [5] | "Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures." Pykalainen A., Boczkowska M., Zhao H., Saarikangas J., Rebowski G., Jansen M., Hakanen J., Koskela E.V., Peranen J., Vihinen H., Jokitalo E., Salminen M., Ikonen E., Dominguez R., Lappalainen P. Nat. Struct. Mol. Biol. 18:902-907(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) OF 1-220, FUNCTION, TISSUE SPECIFICITY, PHOSPHOINOSITIDES-BINDING, MUTAGENESIS OF LYS-109; LYS-116; ILE-124; ARG-127; LYS-135; TRP-141; ARG-145; LYS-146; ARG-147; LYS-149; ARG-152; LYS-155 AND LEU-214. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK143783 mRNA. Translation: BAE25539.1. AL591913 Genomic DNA. No translation available. CH466550 Genomic DNA. Translation: EDL04661.1. BC048937 mRNA. Translation: AAH48937.1. | ||||||||||||
| IPI | IPI00228411. IPI00798612. | ||||||||||||
| RefSeq | NP_808248.1. NM_177580.3. | ||||||||||||
| UniGene | Mm.309647. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q80Y61. | ||||||||||||
| SMR | Q80Y61. Positions 2-220, 323-383. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-59098N. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q80Y61. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q80Y61. | ||||||||||||
| PRIDE | Q80Y61. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000165408; ENSMUSP00000127816; ENSMUSG00000018126. ENSMUST00000170955; ENSMUSP00000125946; ENSMUSG00000018126. | ||||||||||||
| GeneID | 207495. | ||||||||||||
| KEGG | mmu:207495. | ||||||||||||
| UCSC | uc007wtb.1. mouse. uc007wtc.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 80115. | ||||||||||||
| MGI | MGI:2652819. Baiap2l2. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG25242. | ||||||||||||
| GeneTree | ENSGT00390000005995. | ||||||||||||
| HOGENOM | HOG000038005. | ||||||||||||
| HOVERGEN | HBG100621. | ||||||||||||
| InParanoid | Q80Y61. | ||||||||||||
| OMA | TRLDMPP. | ||||||||||||
| OrthoDB | EOG470TH8. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q80Y61. | ||||||||||||
| Bgee | Q80Y61. | ||||||||||||
| CleanEx | MM_BAIAP2L2. | ||||||||||||
| Genevestigator | Q80Y61. | ||||||||||||
| GermOnline | ENSMUSG00000018126. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013606. IRSp53/MIM_homology_IMD. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF08397. IMD. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS51338. IMD. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | BAIAP2L2. mouse. | ||||||||||||
| NextBio | 371953. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BI2L2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q80Y61 Secondary accession number(s): Q3UP58 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
