Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2

Gene

Baiap2l2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Phosphoinositides-binding protein that induces the formation of planar or gently curved membrane structures. Binds to phosphoinositides, including to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) headgroups. There seems to be no clear preference for a specific phosphoinositide.1 Publication

GO - Molecular functioni

  • cytoskeletal adaptor activity Source: GO_Central
  • phospholipid binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
Short name:
BAI1-associated protein 2-like protein 2
Alternative name(s):
Planar intestinal- and kidney-specific BAR domain protein
Short name:
Pinkbar
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2652819. Baiap2l2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi109K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-116. 1 Publication1
Mutagenesisi116K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-109. 1 Publication1
Mutagenesisi124I → S: Partially impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering. 1 Publication1
Mutagenesisi127R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-135. 1 Publication1
Mutagenesisi135K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-127. 1 Publication1
Mutagenesisi141W → S: Deficient in oligomerization (dimerization maintained). Inefficient formation of planar membrane structures. No effect on lipid-binding. 1 Publication1
Mutagenesisi145R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-146 and A-147. 1 Publication1
Mutagenesisi146K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-147. 1 Publication1
Mutagenesisi147R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-146. 1 Publication1
Mutagenesisi149K → A: No effect on lipid-binding; when associated with A-152 and A-155. 1 Publication1
Mutagenesisi152R → A: No effect on lipid-binding; when associated with A-149 and A-155. 1 Publication1
Mutagenesisi155K → A: No effect on lipid-binding; when associated with A-149 and A-152. 1 Publication1
Mutagenesisi214L → S: No effect on lipid-binding. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002561311 – 522Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2Add BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei231PhosphoserineCombined sources1
Modified residuei272PhosphoserineCombined sources1
Modified residuei303PhosphoserineCombined sources1
Modified residuei472PhosphoserineCombined sources1
Modified residuei475PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ80Y61.
PeptideAtlasiQ80Y61.
PRIDEiQ80Y61.

PTM databases

iPTMnetiQ80Y61.
PhosphoSitePlusiQ80Y61.

Expressioni

Tissue specificityi

Expressed in the epithelial layer of the intestine and in the kidney.1 Publication

Gene expression databases

BgeeiENSMUSG00000018126.
CleanExiMM_BAIAP2L2.
ExpressionAtlasiQ80Y61. baseline and differential.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-59098N.

Structurei

Secondary structure

1522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 21Combined sources19
Helixi23 – 64Combined sources42
Beta strandi65 – 67Combined sources3
Helixi69 – 99Combined sources31
Helixi101 – 145Combined sources45
Helixi151 – 215Combined sources65

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3OK8X-ray2.25A/B1-220[»]
ProteinModelPortaliQ80Y61.
SMRiQ80Y61.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 239IMDPROSITE-ProRule annotationAdd BLAST239
Domaini324 – 387SH3PROSITE-ProRule annotationAdd BLAST64

Domaini

The IMD domain consisting of an antiparallel dimer of three-helix bundles, featuring on one side a positively charged. The N-terminal alpha-helix inserts into the lipid bilayer. Also forms homodimers and homooligomers. The residue Trp-141 is essential for oligomer formation.

Sequence similaritiesi

Contains 1 IMD (IRSp53/MIM homology) domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFGP. Eukaryota.
ENOG4111HBF. LUCA.
GeneTreeiENSGT00390000005995.
HOGENOMiHOG000038005.
HOVERGENiHBG100621.
InParanoidiQ80Y61.
KOiK20127.
OMAiPSEYWDG.
OrthoDBiEOG091G05ZV.
PhylomeDBiQ80Y61.
TreeFamiTF325648.

Family and domain databases

InterProiIPR013606. I-BAR_dom.
IPR027681. IRSp53/IRTKS/Pinkbar.
IPR030126. Pinkbar.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR14206. PTHR14206. 2 hits.
PTHR14206:SF5. PTHR14206:SF5. 2 hits.
PfamiPF08397. IMD. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51338. IMD. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80Y61-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPEMDQFYR STMAIYKSIM EQFNPALENL VYLGNNYLRA FHALSEAAEV
60 70 80 90 100
YFSAIQKIGE QALQSSTSQI LGEILVQMSD TQRHLNSDLE VVVQTFHGDL
110 120 130 140 150
LQHMEKNTKL DMQFIKDSCQ HYEIEYRHRA ANLEKCMSEL WRMERKRDKN
160 170 180 190 200
AREMKESVNR LHAQMQAFVS ESKRAAELEE KRRYRFLAEK HLLLSNTFLQ
210 220 230 240 250
FLGRARGMLQ NRVLLWKEQS EASRSPSRAH SPGLLGPALG PPYPSGRLTP
260 270 280 290 300
TRLDMPPRPL GEYGSPRSRH GSGSYGPEPA EARSASQLEP DRRSLPRTPS
310 320 330 340 350
ASSLYASSTQ RSRSNSFGER LGGGGARRVR ALVSHSEGAN HTLLRFSAGD
360 370 380 390 400
VVEVLVPEAQ NGWLYGKLEG SSASGWFPEA YVKPVEEIPV NPMNPVAPMN
410 420 430 440 450
SMAPMSPMNE LPSRSYPLRG SHSLDDLLDR PGNPTASSEY WDSQSRSRTP
460 470 480 490 500
SRVPSRAPSP APPPLPSSRR SSVGSMGAAT DVKKLMSWEQ NPPELFPRGT
510 520
NPFATVKLRP TVTNDRSAPL IR
Length:522
Mass (Da):58,402
Last modified:June 1, 2003 - v1
Checksum:i57403388931471FF
GO
Isoform 2 (identifier: Q80Y61-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-238: ARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPA → VSRAGESKPRPPGAVVRLRRTQEQERSFLPLCFL
     239-522: Missing.

Show »
Length:238
Mass (Da):27,954
Checksum:iED5F84192A0A2227
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021325205 – 238ARGML…LLGPA → VSRAGESKPRPPGAVVRLRR TQEQERSFLPLCFL in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_021326239 – 522Missing in isoform 2. 1 PublicationAdd BLAST284

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK143783 mRNA. Translation: BAE25539.1.
AL591913 Genomic DNA. No translation available.
CH466550 Genomic DNA. Translation: EDL04661.1.
BC048937 mRNA. Translation: AAH48937.1.
CCDSiCCDS37140.1. [Q80Y61-1]
RefSeqiNP_808248.1. NM_177580.3. [Q80Y61-1]
UniGeneiMm.309647.

Genome annotation databases

EnsembliENSMUST00000165408; ENSMUSP00000127816; ENSMUSG00000018126. [Q80Y61-1]
ENSMUST00000170955; ENSMUSP00000125946; ENSMUSG00000018126. [Q80Y61-2]
GeneIDi207495.
KEGGimmu:207495.
UCSCiuc007wtb.1. mouse. [Q80Y61-1]
uc007wtc.1. mouse. [Q80Y61-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK143783 mRNA. Translation: BAE25539.1.
AL591913 Genomic DNA. No translation available.
CH466550 Genomic DNA. Translation: EDL04661.1.
BC048937 mRNA. Translation: AAH48937.1.
CCDSiCCDS37140.1. [Q80Y61-1]
RefSeqiNP_808248.1. NM_177580.3. [Q80Y61-1]
UniGeneiMm.309647.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3OK8X-ray2.25A/B1-220[»]
ProteinModelPortaliQ80Y61.
SMRiQ80Y61.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-59098N.

PTM databases

iPTMnetiQ80Y61.
PhosphoSitePlusiQ80Y61.

Proteomic databases

PaxDbiQ80Y61.
PeptideAtlasiQ80Y61.
PRIDEiQ80Y61.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000165408; ENSMUSP00000127816; ENSMUSG00000018126. [Q80Y61-1]
ENSMUST00000170955; ENSMUSP00000125946; ENSMUSG00000018126. [Q80Y61-2]
GeneIDi207495.
KEGGimmu:207495.
UCSCiuc007wtb.1. mouse. [Q80Y61-1]
uc007wtc.1. mouse. [Q80Y61-2]

Organism-specific databases

CTDi80115.
MGIiMGI:2652819. Baiap2l2.

Phylogenomic databases

eggNOGiENOG410IFGP. Eukaryota.
ENOG4111HBF. LUCA.
GeneTreeiENSGT00390000005995.
HOGENOMiHOG000038005.
HOVERGENiHBG100621.
InParanoidiQ80Y61.
KOiK20127.
OMAiPSEYWDG.
OrthoDBiEOG091G05ZV.
PhylomeDBiQ80Y61.
TreeFamiTF325648.

Miscellaneous databases

ChiTaRSiBaiap2l2. mouse.
PROiQ80Y61.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000018126.
CleanExiMM_BAIAP2L2.
ExpressionAtlasiQ80Y61. baseline and differential.

Family and domain databases

InterProiIPR013606. I-BAR_dom.
IPR027681. IRSp53/IRTKS/Pinkbar.
IPR030126. Pinkbar.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR14206. PTHR14206. 2 hits.
PTHR14206:SF5. PTHR14206:SF5. 2 hits.
PfamiPF08397. IMD. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS51338. IMD. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBI2L2_MOUSE
AccessioniPrimary (citable) accession number: Q80Y61
Secondary accession number(s): Q3UP58
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2003
Last modified: November 2, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.