Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q80Y61 (BI2L2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2

Short name=BAI1-associated protein 2-like protein 2
Alternative name(s):
Planar intestinal- and kidney-specific BAR domain protein
Short name=Pinkbar
Gene names
Name:Baiap2l2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length522 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Phosphoinositides-binding protein that induces the formation of planar or gently curved membrane structures. Binds to phosphoinositides, including to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) headgroups. There seems to be no clear preference for a specific phosphoinositide. Ref.5

Subcellular location

Cell membrane; Peripheral membrane protein By similarity. Cell junction By similarity. Cytoplasmic vesicle membrane By similarity. Note: Localizes to RAB13-positive vesicles and to the plasma membrane at intercellular contacts By similarity.

Tissue specificity

Expressed in the epithelial layer of the intestine and in the kidney. Ref.5

Domain

The IMD domain consisting of an antiparallel dimer of three-helix bundles, featuring on one side a positively charged. The N-terminal alpha-helix inserts into the lipid bilayer. Also forms homodimers and homooligomers. The residue Trp-141 is essential for oligomer formation.

Sequence similarities

Contains 1 IMD (IRSp53/MIM homology) domain.

Contains 1 SH3 domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q80Y61-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q80Y61-2)

The sequence of this isoform differs from the canonical sequence as follows:
     205-238: ARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPA → VSRAGESKPRPPGAVVRLRRTQEQERSFLPLCFL
     239-522: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 522522Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
PRO_0000256131

Regions

Domain1 – 239239IMD
Domain324 – 38764SH3

Natural variations

Alternative sequence205 – 23834ARGML…LLGPA → VSRAGESKPRPPGAVVRLRR TQEQERSFLPLCFL in isoform 2.
VSP_021325
Alternative sequence239 – 522284Missing in isoform 2.
VSP_021326

Experimental info

Mutagenesis1091K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-116. Ref.5
Mutagenesis1161K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-109. Ref.5
Mutagenesis1241I → S: Partially impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering. Ref.5
Mutagenesis1271R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-135. Ref.5
Mutagenesis1351K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-127. Ref.5
Mutagenesis1411W → S: Deficient in oligomerization (dimerization maintained). Inefficient formation of planar membrane structures. No effect on lipid-binding. Ref.5
Mutagenesis1451R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-146 and A-147. Ref.5
Mutagenesis1461K → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-147. Ref.5
Mutagenesis1471R → A: Impairs lipid-binding activity and hence PtdIns(4,5)P2 clustering; when associated with A-145 and A-146. Ref.5
Mutagenesis1491K → A: No effect on lipid-binding; when associated with A-152 and A-155. Ref.5
Mutagenesis1521R → A: No effect on lipid-binding; when associated with A-149 and A-155. Ref.5
Mutagenesis1551K → A: No effect on lipid-binding; when associated with A-149 and A-152. Ref.5
Mutagenesis2141L → S: No effect on lipid-binding. Ref.5

Secondary structure

............ 522
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2003. Version 1.
Checksum: 57403388931471FF

FASTA52258,402
        10         20         30         40         50         60 
MAPEMDQFYR STMAIYKSIM EQFNPALENL VYLGNNYLRA FHALSEAAEV YFSAIQKIGE 

        70         80         90        100        110        120 
QALQSSTSQI LGEILVQMSD TQRHLNSDLE VVVQTFHGDL LQHMEKNTKL DMQFIKDSCQ 

       130        140        150        160        170        180 
HYEIEYRHRA ANLEKCMSEL WRMERKRDKN AREMKESVNR LHAQMQAFVS ESKRAAELEE 

       190        200        210        220        230        240 
KRRYRFLAEK HLLLSNTFLQ FLGRARGMLQ NRVLLWKEQS EASRSPSRAH SPGLLGPALG 

       250        260        270        280        290        300 
PPYPSGRLTP TRLDMPPRPL GEYGSPRSRH GSGSYGPEPA EARSASQLEP DRRSLPRTPS 

       310        320        330        340        350        360 
ASSLYASSTQ RSRSNSFGER LGGGGARRVR ALVSHSEGAN HTLLRFSAGD VVEVLVPEAQ 

       370        380        390        400        410        420 
NGWLYGKLEG SSASGWFPEA YVKPVEEIPV NPMNPVAPMN SMAPMSPMNE LPSRSYPLRG 

       430        440        450        460        470        480 
SHSLDDLLDR PGNPTASSEY WDSQSRSRTP SRVPSRAPSP APPPLPSSRR SSVGSMGAAT 

       490        500        510        520 
DVKKLMSWEQ NPPELFPRGT NPFATVKLRP TVTNDRSAPL IR 

« Hide

Isoform 2 [UniParc].

Checksum: ED5F84192A0A2227
Show »

FASTA23827,954

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Spleen.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: FVB/N.
Tissue: Colon.
[5]"Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures."
Pykalainen A., Boczkowska M., Zhao H., Saarikangas J., Rebowski G., Jansen M., Hakanen J., Koskela E.V., Peranen J., Vihinen H., Jokitalo E., Salminen M., Ikonen E., Dominguez R., Lappalainen P.
Nat. Struct. Mol. Biol. 18:902-907(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) OF 1-220, FUNCTION, TISSUE SPECIFICITY, PHOSPHOINOSITIDES-BINDING, MUTAGENESIS OF LYS-109; LYS-116; ILE-124; ARG-127; LYS-135; TRP-141; ARG-145; LYS-146; ARG-147; LYS-149; ARG-152; LYS-155 AND LEU-214.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK143783 mRNA. Translation: BAE25539.1.
AL591913 Genomic DNA. No translation available.
CH466550 Genomic DNA. Translation: EDL04661.1.
BC048937 mRNA. Translation: AAH48937.1.
RefSeqNP_808248.1. NM_177580.3.
UniGeneMm.309647.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3OK8X-ray2.25A/B1-220[»]
ProteinModelPortalQ80Y61.
SMRQ80Y61. Positions 2-220, 323-383.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-59098N.

PTM databases

PhosphoSiteQ80Y61.

Proteomic databases

PaxDbQ80Y61.
PRIDEQ80Y61.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000165408; ENSMUSP00000127816; ENSMUSG00000018126. [Q80Y61-1]
ENSMUST00000170955; ENSMUSP00000125946; ENSMUSG00000018126. [Q80Y61-2]
GeneID207495.
KEGGmmu:207495.
UCSCuc007wtb.1. mouse. [Q80Y61-1]
uc007wtc.1. mouse. [Q80Y61-2]

Organism-specific databases

CTD80115.
MGIMGI:2652819. Baiap2l2.

Phylogenomic databases

eggNOGNOG25242.
GeneTreeENSGT00390000005995.
HOGENOMHOG000038005.
HOVERGENHBG100621.
InParanoidQ80Y61.
OMARKRDKNV.
OrthoDBEOG7N0C3W.
PhylomeDBQ80Y61.
TreeFamTF325648.

Gene expression databases

BgeeQ80Y61.
CleanExMM_BAIAP2L2.
GenevestigatorQ80Y61.

Family and domain databases

InterProIPR027681. BAIAP2.
IPR013606. IRSp53/MIM_homology_IMD.
IPR001452. SH3_domain.
[Graphical view]
PANTHERPTHR14206. PTHR14206. 1 hit.
PfamPF08397. IMD. 1 hit.
[Graphical view]
SMARTSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 1 hit.
PROSITEPS51338. IMD. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSBAIAP2L2. mouse.
NextBio371953.
PROQ80Y61.
SOURCESearch...

Entry information

Entry nameBI2L2_MOUSE
AccessionPrimary (citable) accession number: Q80Y61
Secondary accession number(s): Q3UP58
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2003
Last modified: April 16, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot