Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 34

Gene

Fbxo34

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

Keywords - Biological processi

Ubl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 34
Gene namesi
Name:Fbxo34
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1926188. Fbxo34.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 695695F-box only protein 34PRO_0000119927Add
BLAST

Proteomic databases

EPDiQ80XI1.
PaxDbiQ80XI1.
PRIDEiQ80XI1.

PTM databases

iPTMnetiQ80XI1.
PhosphoSiteiQ80XI1.

Expressioni

Gene expression databases

BgeeiQ80XI1.
CleanExiMM_FBXO34.
ExpressionAtlasiQ80XI1. baseline and differential.
GenevisibleiQ80XI1. MM.

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Protein-protein interaction databases

BioGridi219722. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ80XI1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini556 – 60853F-boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 F-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IJQD. Eukaryota.
ENOG410ZZJ3. LUCA.
GeneTreeiENSGT00530000064222.
HOGENOMiHOG000237319.
HOVERGENiHBG051576.
InParanoidiQ80XI1.
KOiK10311.
PhylomeDBiQ80XI1.

Family and domain databases

InterProiIPR001810. F-box_dom.
[Graphical view]
PfamiPF00646. F-box. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80XI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHLKLYWKLQ KKERPLEVSR DTLRTPMSHG KANGDVKARA SYMKPTVLPS
60 70 80 90 100
ASLVKASSRK PFGILSPNVL CSMSGKSPVE NSLNVKAKKN VLSAAVHQSE
110 120 130 140 150
EGLPGTWAIV KPGNTKEKIA FFAAHQYSNR IGSMKIKSSW DIDGRATKRR
160 170 180 190 200
KKSGDLKKAK LQLEMMREIN SQCYQSEPFV CGVEHCSVHY MSDSGDGVCA
210 220 230 240 250
ARPLSVIQMV AFLEQKATAL LASCTKNCTN SPAIVKISGQ SRGIPPAPEP
260 270 280 290 300
FSAPETCEEP KEQENPETGR SQGEPVRVLD MVARLESECL KHQGQREPGS
310 320 330 340 350
LSRNNSFRRN VGRVLLTNGS QASDKSEEGS ADTADPQENP LQPVSVGEEP
360 370 380 390 400
SVTEHHSVGE QAWDGTSQSC PSLPATVSFH MDSTDLEPGQ QTAMKSCSRD
410 420 430 440 450
DVEMVEEFDE LPTDAVRRIR RELVTVTKHS PEQRQDPLCI SITVCTVEKD
460 470 480 490 500
RPAALDSLEE PLPGMLFFLS SGQDQQAHPQ LREHPAPEAS EASQPQDAAE
510 520 530 540 550
GSSAGEEKDA SVEPLLPAAS PGGSTSQVLE AATCKKQVSQ DFLETRFKIQ
560 570 580 590 600
QLLEPQQYMA CLPHHIIVKI FRLLPTLSLA ILKCTCRYFK SIIEYYNIRP
610 620 630 640 650
ADSRWVRDPR YREDPCKQCK KKYVKGDVSL CRWHPKPYCQ ALPYGPGYWM
660 670 680 690
CCHQSQKGFP GCKLGLHDNH WLPACHSFNR AIHKKTRGSE TEEEY
Length:695
Mass (Da):77,138
Last modified:March 15, 2005 - v2
Checksum:iD97EFBB6588E5FCC
GO
Isoform 2 (identifier: Q80XI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGFGASVGLRRSALSSWSASVSGSESGLPPPHRAAAAPGQALARQKHRASV

Note: No experimental confirmation available.
Show »
Length:745
Mass (Da):82,102
Checksum:iA232A91D83ACA844
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti165 – 1651M → I in AAH48149 (PubMed:15489334).Curated
Sequence conflicti236 – 2361K → E in BAB31968 (PubMed:16141072).Curated
Sequence conflicti491 – 4911E → K in BAB31968 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGFGASVGLRRSALSSWSAS VSGSESGLPPPHRAAAAPGQ ALARQKHRASV in isoform 2. 1 PublicationVSP_013055

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK020018 mRNA. Translation: BAB31968.1.
BC048149 mRNA. Translation: AAH48149.1.
CCDSiCCDS49471.1. [Q80XI1-1]
RefSeqiNP_001139557.1. NM_001146085.1. [Q80XI1-1]
NP_001139558.1. NM_001146086.1. [Q80XI1-1]
NP_084512.2. NM_030236.3.
XP_006519776.1. XM_006519713.1. [Q80XI1-1]
XP_006519777.1. XM_006519714.1. [Q80XI1-1]
XP_006519780.1. XM_006519717.2. [Q80XI1-1]
XP_006519781.1. XM_006519718.2. [Q80XI1-1]
XP_006519782.1. XM_006519719.1. [Q80XI1-1]
XP_006519783.1. XM_006519720.1. [Q80XI1-1]
XP_006519785.1. XM_006519722.1. [Q80XI1-1]
XP_006519786.1. XM_006519723.2. [Q80XI1-1]
XP_011243531.1. XM_011245229.1. [Q80XI1-1]
UniGeneiMm.11935.

Genome annotation databases

EnsembliENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536. [Q80XI1-1]
GeneIDi78938.
KEGGimmu:78938.
UCSCiuc007tih.2. mouse. [Q80XI1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK020018 mRNA. Translation: BAB31968.1.
BC048149 mRNA. Translation: AAH48149.1.
CCDSiCCDS49471.1. [Q80XI1-1]
RefSeqiNP_001139557.1. NM_001146085.1. [Q80XI1-1]
NP_001139558.1. NM_001146086.1. [Q80XI1-1]
NP_084512.2. NM_030236.3.
XP_006519776.1. XM_006519713.1. [Q80XI1-1]
XP_006519777.1. XM_006519714.1. [Q80XI1-1]
XP_006519780.1. XM_006519717.2. [Q80XI1-1]
XP_006519781.1. XM_006519718.2. [Q80XI1-1]
XP_006519782.1. XM_006519719.1. [Q80XI1-1]
XP_006519783.1. XM_006519720.1. [Q80XI1-1]
XP_006519785.1. XM_006519722.1. [Q80XI1-1]
XP_006519786.1. XM_006519723.2. [Q80XI1-1]
XP_011243531.1. XM_011245229.1. [Q80XI1-1]
UniGeneiMm.11935.

3D structure databases

ProteinModelPortaliQ80XI1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi219722. 2 interactions.

PTM databases

iPTMnetiQ80XI1.
PhosphoSiteiQ80XI1.

Proteomic databases

EPDiQ80XI1.
PaxDbiQ80XI1.
PRIDEiQ80XI1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000095941; ENSMUSP00000093634; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000163324; ENSMUSP00000131708; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000165714; ENSMUSP00000130036; ENSMUSG00000037536. [Q80XI1-1]
ENSMUST00000168833; ENSMUSP00000132271; ENSMUSG00000037536. [Q80XI1-1]
GeneIDi78938.
KEGGimmu:78938.
UCSCiuc007tih.2. mouse. [Q80XI1-1]

Organism-specific databases

CTDi55030.
MGIiMGI:1926188. Fbxo34.

Phylogenomic databases

eggNOGiENOG410IJQD. Eukaryota.
ENOG410ZZJ3. LUCA.
GeneTreeiENSGT00530000064222.
HOGENOMiHOG000237319.
HOVERGENiHBG051576.
InParanoidiQ80XI1.
KOiK10311.
PhylomeDBiQ80XI1.

Miscellaneous databases

ChiTaRSiFbxo34. mouse.
PROiQ80XI1.
SOURCEiSearch...

Gene expression databases

BgeeiQ80XI1.
CleanExiMM_FBXO34.
ExpressionAtlasiQ80XI1. baseline and differential.
GenevisibleiQ80XI1. MM.

Family and domain databases

InterProiIPR001810. F-box_dom.
[Graphical view]
PfamiPF00646. F-box. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.

Entry informationi

Entry nameiFBX34_MOUSE
AccessioniPrimary (citable) accession number: Q80XI1
Secondary accession number(s): Q9D290
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 15, 2005
Last modified: June 8, 2016
This is version 87 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.