Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synembryn-B

Gene

Ric8b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Synembryn-B
Alternative name(s):
Protein Ric-8B
Gene namesi
Name:Ric8b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:2682307. Ric8b.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 520520Synembryn-BPRO_0000235900Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei468 – 4681PhosphoserineCombined sources
Modified residuei473 – 4731PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ80XE1.
MaxQBiQ80XE1.
PeptideAtlasiQ80XE1.
PRIDEiQ80XE1.

PTM databases

iPTMnetiQ80XE1.
PhosphoSiteiQ80XE1.

Expressioni

Tissue specificityi

Predominantly expressed in the mature olfactory sensory neurons and also in a few regions in the brain.1 Publication

Gene expression databases

BgeeiQ80XE1.
GenevisibleiQ80XE1. MM.

Interactioni

Subunit structurei

Interacts with GDP-bound G alpha proteins GNAI1, GNAL, GNAS and GNAQ. Does not interact with G-alpha proteins when they are in complex with subunits beta and gamma.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231877. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ80XE1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the synembryn family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000014700.
HOGENOMiHOG000236345.
HOVERGENiHBG054867.
InParanoidiQ80XE1.
OMAiYKSAKPN.
OrthoDBiEOG72JWG4.
PhylomeDBiQ80XE1.
TreeFamiTF314907.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR019318. Gua_nucleotide_exch_fac_Ric8.
IPR008376. Synembryn.
[Graphical view]
PfamiPF10165. Ric8. 1 hit.
[Graphical view]
PRINTSiPR01802. SYNEMBRYN.
SUPFAMiSSF48371. SSF48371. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q80XE1-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEERALYIV RAGEAGAIER VLRDYSDKHR ATFKFESADE DKRKKLCEGI
60 70 80 90 100
FKVLVKEVPT TCQVSCLEVL RILSRDKKIL VPVTTKENMQ ILLRLAKLHE
110 120 130 140 150
SDDSLEKVSE FPVIVESLKC LCNIVFNSQM AQQLSLELNL AAKLCNLLRK
160 170 180 190 200
CKDRKFINDI KCFDLRLLFV LSLLHTDIRS QLRYELQGLP LLTQILESAF
210 220 230 240 250
SIKWTDEYES AIDHNGPPLS PQETDCAIEA LKALFNVTVD SWKVHKESDS
260 270 280 290 300
HQFRVMAAVL RHCLLIVGPT EDKTEELHSN AVNLLSNVPV SCLDVLICPL
310 320 330 340 350
THEETAQEAA TLDELPSDKT TEKDTALKNS TMVYNGMNME AIHVLLNFME
360 370 380 390 400
KRIDKGSSYR EGLTPVLSLL TECSRAHRNI RKFLKDQVLP PLRDVTNRPE
410 420 430 440 450
VGSTVRNKLV RLMTHVDLGV KQIAAEFLFV LCKERVDSLL KYTGYGNAAG
460 470 480 490 500
LLAARGLLAG GRGDNWYSED EDTDTEEYKN AKPKEELLKP MGLKPDGTIT
510 520
PLEEALSQYS VIEETSSDTD
Length:520
Mass (Da):58,683
Last modified:October 5, 2010 - v2
Checksum:i79FACBB0C462F7A3
GO
Isoform 1 (identifier: Q80XE1-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     484-484: K → NINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSR

Show »
Length:560
Mass (Da):63,352
Checksum:iA1C6943E5CC959D7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei484 – 4841K → NINLITGHLEEPMPNPIDEM TEEQKEYEAMKLVNMLDKLS R in isoform 1. 2 PublicationsVSP_039867

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY940666 mRNA. Translation: AAX46315.1.
AY940667 mRNA. Translation: AAX46316.1.
AK132369 mRNA. Translation: BAE21130.1.
BC051080 mRNA. Translation: AAH51080.1.
CCDSiCCDS24084.1. [Q80XE1-2]
CCDS24085.1. [Q80XE1-1]
RefSeqiNP_001013459.1. NM_001013441.2. [Q80XE1-2]
NP_898995.1. NM_183172.2. [Q80XE1-1]
UniGeneiMm.18936.

Genome annotation databases

EnsembliENSMUST00000038523; ENSMUSP00000046981; ENSMUSG00000035620. [Q80XE1-1]
ENSMUST00000095385; ENSMUSP00000093032; ENSMUSG00000035620. [Q80XE1-2]
GeneIDi237422.
KEGGimmu:237422.
UCSCiuc007gkx.2. mouse. [Q80XE1-1]
uc007gky.2. mouse. [Q80XE1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY940666 mRNA. Translation: AAX46315.1.
AY940667 mRNA. Translation: AAX46316.1.
AK132369 mRNA. Translation: BAE21130.1.
BC051080 mRNA. Translation: AAH51080.1.
CCDSiCCDS24084.1. [Q80XE1-2]
CCDS24085.1. [Q80XE1-1]
RefSeqiNP_001013459.1. NM_001013441.2. [Q80XE1-2]
NP_898995.1. NM_183172.2. [Q80XE1-1]
UniGeneiMm.18936.

3D structure databases

ProteinModelPortaliQ80XE1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231877. 2 interactions.

PTM databases

iPTMnetiQ80XE1.
PhosphoSiteiQ80XE1.

Proteomic databases

EPDiQ80XE1.
MaxQBiQ80XE1.
PeptideAtlasiQ80XE1.
PRIDEiQ80XE1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038523; ENSMUSP00000046981; ENSMUSG00000035620. [Q80XE1-1]
ENSMUST00000095385; ENSMUSP00000093032; ENSMUSG00000035620. [Q80XE1-2]
GeneIDi237422.
KEGGimmu:237422.
UCSCiuc007gkx.2. mouse. [Q80XE1-1]
uc007gky.2. mouse. [Q80XE1-2]

Organism-specific databases

CTDi55188.
MGIiMGI:2682307. Ric8b.

Phylogenomic databases

GeneTreeiENSGT00390000014700.
HOGENOMiHOG000236345.
HOVERGENiHBG054867.
InParanoidiQ80XE1.
OMAiYKSAKPN.
OrthoDBiEOG72JWG4.
PhylomeDBiQ80XE1.
TreeFamiTF314907.

Miscellaneous databases

ChiTaRSiRic8b. mouse.
PROiQ80XE1.
SOURCEiSearch...

Gene expression databases

BgeeiQ80XE1.
GenevisibleiQ80XE1. MM.

Family and domain databases

Gene3Di1.25.10.10. 3 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR019318. Gua_nucleotide_exch_fac_Ric8.
IPR008376. Synembryn.
[Graphical view]
PfamiPF10165. Ric8. 1 hit.
[Graphical view]
PRINTSiPR01802. SYNEMBRYN.
SUPFAMiSSF48371. SSF48371. 2 hits.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Ric-8B, an olfactory putative GTP exchange factor, amplifies signal transduction through the olfactory-specific G-protein Galphaolf."
    Von Dannecker L.E.C., Mercadante A.F., Malnic B.
    J. Neurosci. 25:3793-3800(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH GNAL.
    Strain: C57BL/6J.
    Tissue: Olfactory epithelium.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Head.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-468 AND THR-473, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Heart, Kidney and Lung.

Entry informationi

Entry nameiRIC8B_MOUSE
AccessioniPrimary (citable) accession number: Q80XE1
Secondary accession number(s): Q58L65
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 5, 2010
Last modified: July 6, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.