Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-associated protein 2-like

Gene

Ubap2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT-HSCs) (PubMed:25185265).1 Publication

GO - Molecular functioni

GO - Biological processi

  • binding of sperm to zona pellucida Source: Ensembl
  • hematopoietic stem cell homeostasis Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-associated protein 2-like
Gene namesi
Name:Ubap2l
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1921633. Ubap2l.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11071107Ubiquitin-associated protein 2-likePRO_0000240665Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei436 – 4361PhosphoserineCombined sources
Modified residuei445 – 4451PhosphothreonineBy similarity
Modified residuei474 – 4741PhosphoserineBy similarity
Modified residuei487 – 4871PhosphoserineCombined sources
Modified residuei490 – 4901PhosphoserineBy similarity
Modified residuei491 – 4911PhosphoserineBy similarity
Modified residuei497 – 4971PhosphoserineCombined sources
Modified residuei625 – 6251PhosphoserineCombined sources
Modified residuei628 – 6281PhosphoserineBy similarity
Modified residuei629 – 6291PhosphoserineCombined sources
Modified residuei872 – 8721PhosphoserineBy similarity
Modified residuei879 – 8791PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ80X50.
MaxQBiQ80X50.
PaxDbiQ80X50.
PRIDEiQ80X50.

PTM databases

iPTMnetiQ80X50.
PhosphoSiteiQ80X50.

Expressioni

Gene expression databases

BgeeiQ80X50.
CleanExiMM_UBAP2L.
ExpressionAtlasiQ80X50. baseline and differential.
GenevisibleiQ80X50. MM.

Interactioni

Subunit structurei

Interacts with BMI1. Part of a complex consisting of UBAP2L, BMI1 and RNF2.By similarity

Protein-protein interaction databases

BioGridi216707. 3 interactions.
MINTiMINT-1870293.
STRINGi10090.ENSMUSP00000066138.

Structurei

Secondary structure

1
1107
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi28 – 325Combined sources
Helixi33 – 4412Combined sources
Helixi48 – 6013Combined sources
Helixi65 – 7511Combined sources
Helixi79 – 879Combined sources
Beta strandi90 – 923Combined sources
Beta strandi105 – 1095Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WJ7NMR-A19-109[»]
ProteinModelPortaliQ80X50.
SMRiQ80X50. Positions 19-111.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ80X50.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini49 – 8941UBAPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi124 – 19067Arg/Gly-richAdd
BLAST
Compositional biasi469 – 4724Poly-Pro
Compositional biasi473 – 799327Ser/Thr-richAdd
BLAST

Sequence similaritiesi

Contains 1 UBA domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
GeneTreeiENSGT00390000003453.
HOVERGENiHBG058387.
InParanoidiQ80X50.
OMAiAITQPAS.
OrthoDBiEOG7Z95KJ.
PhylomeDBiQ80X50.
TreeFamiTF328468.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80X50-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMTSVGTNRA RGNWEQPQNQ NQTQHKQRPQ ATAEQIRLAQ MISDHNDADF
60 70 80 90 100
EEKVKQLIDI TGKNQDECVI ALHDCNGDVN RAINVLLEGN PDTHSWEMVG
110 120 130 140 150
KKKGVSGQKD GGQTESNEEG KENRDRDRDY SRRRGGPPRR GRGASRGREF
160 170 180 190 200
RGQENGLDGT KSGGPSGRGT DRGRRGRGRG RGSSGRRGGR FSAQGMGTFN
210 220 230 240 250
PADYAEPANT DDNYGNSSGN TWNNTGHFEP DDGTRLDFIG VEGSNYPRKF
260 270 280 290 300
ETAPGAWRTA TEEWGTEDWN EDLSETKIFT ASNVSSVPLP AENVTITAGQ
310 320 330 340 350
RIDLAVLLGK TPSSMENDSS NLDPSQAPSL AQPLVFSNSK QNAISQPASG
360 370 380 390 400
STFSHHSMVS MLGKGFGDVG EAKGGSTTGS QFLEQFKTAQ ALAQLAAQHS
410 420 430 440 450
QSGSTTTSSW DMGSTTQSPS LVQYDLKSAN DSTVHSPFTK RQAFTPSSTM
460 470 480 490 500
MEVFLQEKPP AVATSTAAPP PPSSPLPSKS TSAPQMSPGS SDNQSSSPQP
510 520 530 540 550
AQQKLKQQKK KTSLTSKIPA LAVEMPGSAD ISGLNLQFGA LQFGSEPVLS
560 570 580 590 600
DYESTPTTSA SSSQAPSSLY TSTASESSST VSSNQSQESG YQSGPIQSTT
610 620 630 640 650
YTSQNNAQGP LYEQRSTQTR RYPSSISSSP QKDLTQAKNG FSSVQATQLQ
660 670 680 690 700
TTQSVEGATG SAVKSESPST SSIPSLNETV PAASLLTTAN QHSSSLSGLS
710 720 730 740 750
HTEEIPNTTT TQHSSALSTQ QNTLSSSTSS GRTSTSTLLH TSVESEANLH
760 770 780 790 800
SSSSTFSTTS STVSAPPPVV SVSSSLNSGS SLGLSLGSNS TVTASTRSSV
810 820 830 840 850
ATTSGKAPPN LPPGVPPLLP NPYIMAPGLL HAYPPQVYGY DDLQMLQTRF
860 870 880 890 900
PLDYYSIPFP TPTTPLTGRD GSLASNPYSG DLTKFGRGDA SSPAPATTLA
910 920 930 940 950
QPQQNQTQTH HTTQQTFLNP ALPPGYSYTS LPYYTGVPGL PSTFQYGPAV
960 970 980 990 1000
FPVAPTSSKQ HGVNVSVNAS ATPFQQPSGY GSHGYNTGVS VTSSNTGVPD
1010 1020 1030 1040 1050
ISGSVYSKTQ QSFEKQGFHS GTPAASFNLP SALGSGGPIN PATAAAYPPA
1060 1070 1080 1090 1100
PFMHILTPHQ QPHSQILHHH LQQDGQTGSG QRSQTSSIPQ KPQTNKSAYN

SYSWGAN
Length:1,107
Mass (Da):116,799
Last modified:June 1, 2003 - v1
Checksum:iF4A4FB502B619C51
GO
Isoform 2 (identifier: Q80X50-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: F → CMHGALSKPAVV
     989-1107: VSVTSSNTGV...AYNSYSWGAN → RKYPPPYKHFWTAES

Show »
Length:1,014
Mass (Da):107,242
Checksum:i7672DF250DB63179
GO
Isoform 3 (identifier: Q80X50-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     235-255: RLDFIGVEGSNYPRKFETAPG → S
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → DILTLVDDQLGE

Show »
Length:1,068
Mass (Da):112,549
Checksum:i3645335AD2E03879
GO
Isoform 4 (identifier: Q80X50-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → LPYLQMILCCQRQQEEQDILTLVDDQLGE

Show »
Length:1,105
Mass (Da):116,903
Checksum:i3DD82C85DE1B188A
GO
Isoform 5 (identifier: Q80X50-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-255: G → GMIHPG

Show »
Length:1,112
Mass (Da):117,335
Checksum:i3713A6AA077BD17B
GO

Sequence cautioni

The sequence BAC37777.1 differs from that shown. Reason: Frameshift at positions 444, 462 and 476. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti303 – 3031D → G in BAC33295 (PubMed:16141072).Curated
Sequence conflicti1010 – 10101Missing in AAH23906 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti374 – 3741G → S in strain: FVB/N. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei150 – 1501F → CMHGALSKPAVV in isoform 2. 1 PublicationVSP_019418
Alternative sequencei235 – 25521RLDFI…ETAPG → S in isoform 3. 1 PublicationVSP_019419Add
BLAST
Alternative sequencei255 – 2551G → GMIHPG in isoform 5. 1 PublicationVSP_019420
Alternative sequencei989 – 1107119VSVTS…SWGAN → RKYPPPYKHFWTAES in isoform 2. 1 PublicationVSP_019421Add
BLAST
Alternative sequencei1077 – 110731TGSGQ…SWGAN → DILTLVDDQLGE in isoform 3. 1 PublicationVSP_019422Add
BLAST
Alternative sequencei1077 – 110731TGSGQ…SWGAN → LPYLQMILCCQRQQEEQDIL TLVDDQLGE in isoform 4. 1 PublicationVSP_019423Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014274 mRNA. Translation: BAB29236.1.
AK048286 mRNA. Translation: BAC33295.1.
AK079895 mRNA. Translation: BAC37777.1. Frameshift.
AK088702 mRNA. Translation: BAC40514.1.
BC023906 mRNA. Translation: AAH23906.1.
BC029075 mRNA. Translation: AAH29075.1.
BC050910 mRNA. Translation: AAH50910.1.
CCDSiCCDS38498.1. [Q80X50-4]
CCDS50965.1. [Q80X50-2]
CCDS50966.1. [Q80X50-5]
CCDS79960.1. [Q80X50-1]
RefSeqiNP_001159455.1. NM_001165983.1. [Q80X50-5]
NP_001159456.1. NM_001165984.1. [Q80X50-1]
NP_001159457.1. NM_001165985.1. [Q80X50-2]
NP_001159458.1. NM_001165986.1. [Q80X50-2]
NP_082751.1. NM_028475.2. [Q80X50-4]
XP_006502235.1. XM_006502172.2. [Q80X50-5]
UniGeneiMm.25610.
Mm.441742.

Genome annotation databases

EnsembliENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520. [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520. [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520. [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520. [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520. [Q80X50-2]
GeneIDi74383.
KEGGimmu:74383.
UCSCiuc008qal.2. mouse. [Q80X50-4]
uc008qam.2. mouse. [Q80X50-3]
uc008qao.2. mouse. [Q80X50-1]
uc008qap.2. mouse. [Q80X50-5]
uc008qas.2. mouse. [Q80X50-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014274 mRNA. Translation: BAB29236.1.
AK048286 mRNA. Translation: BAC33295.1.
AK079895 mRNA. Translation: BAC37777.1. Frameshift.
AK088702 mRNA. Translation: BAC40514.1.
BC023906 mRNA. Translation: AAH23906.1.
BC029075 mRNA. Translation: AAH29075.1.
BC050910 mRNA. Translation: AAH50910.1.
CCDSiCCDS38498.1. [Q80X50-4]
CCDS50965.1. [Q80X50-2]
CCDS50966.1. [Q80X50-5]
CCDS79960.1. [Q80X50-1]
RefSeqiNP_001159455.1. NM_001165983.1. [Q80X50-5]
NP_001159456.1. NM_001165984.1. [Q80X50-1]
NP_001159457.1. NM_001165985.1. [Q80X50-2]
NP_001159458.1. NM_001165986.1. [Q80X50-2]
NP_082751.1. NM_028475.2. [Q80X50-4]
XP_006502235.1. XM_006502172.2. [Q80X50-5]
UniGeneiMm.25610.
Mm.441742.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WJ7NMR-A19-109[»]
ProteinModelPortaliQ80X50.
SMRiQ80X50. Positions 19-111.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216707. 3 interactions.
MINTiMINT-1870293.
STRINGi10090.ENSMUSP00000066138.

PTM databases

iPTMnetiQ80X50.
PhosphoSiteiQ80X50.

Proteomic databases

EPDiQ80X50.
MaxQBiQ80X50.
PaxDbiQ80X50.
PRIDEiQ80X50.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520. [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520. [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520. [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520. [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520. [Q80X50-2]
GeneIDi74383.
KEGGimmu:74383.
UCSCiuc008qal.2. mouse. [Q80X50-4]
uc008qam.2. mouse. [Q80X50-3]
uc008qao.2. mouse. [Q80X50-1]
uc008qap.2. mouse. [Q80X50-5]
uc008qas.2. mouse. [Q80X50-2]

Organism-specific databases

CTDi9898.
MGIiMGI:1921633. Ubap2l.

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
GeneTreeiENSGT00390000003453.
HOVERGENiHBG058387.
InParanoidiQ80X50.
OMAiAITQPAS.
OrthoDBiEOG7Z95KJ.
PhylomeDBiQ80X50.
TreeFamiTF328468.

Miscellaneous databases

ChiTaRSiUbap2l. mouse.
EvolutionaryTraceiQ80X50.
PROiQ80X50.
SOURCEiSearch...

Gene expression databases

BgeeiQ80X50.
CleanExiMM_UBAP2L.
ExpressionAtlasiQ80X50. baseline and differential.
GenevisibleiQ80X50. MM.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Strain: C57BL/6J.
    Tissue: Embryonic head and Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), VARIANT SER-374.
    Strain: C57BL/6J and FVB/N.
    Tissue: Brain, Eye, Mammary gland and Mammary tumor.
  3. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
    Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
    Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-497, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  5. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-625 AND SER-629, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-436; SER-487; SER-497 AND SER-879, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.
  8. Cited for: FUNCTION.
  9. "Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA."
    RIKEN structural genomics initiative (RSGI)
    Submitted (SEP-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 19-109.

Entry informationi

Entry nameiUBP2L_MOUSE
AccessioniPrimary (citable) accession number: Q80X50
Secondary accession number(s): Q8BIT6
, Q8BIW4, Q8BJ01, Q8CIG7, Q8K102, Q9CRT6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 1, 2003
Last modified: June 8, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.