Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-associated protein 2-like

Gene

Ubap2l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the activity of long-term repopulating hematopoietic stem cells (LT-HSCs) (PubMed:25185265).1 Publication

GO - Molecular functioni

GO - Biological processi

  • binding of sperm to zona pellucida Source: Ensembl
  • hematopoietic stem cell homeostasis Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-associated protein 2-like
Gene namesi
Name:Ubap2l
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1921633. Ubap2l.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002406651 – 1107Ubiquitin-associated protein 2-likeAdd BLAST1107

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei187Asymmetric dimethylarginineBy similarity1
Modified residuei190Asymmetric dimethylarginineBy similarity1
Modified residuei376PhosphoserineBy similarity1
Modified residuei380PhosphoserineBy similarity1
Modified residuei436PhosphoserineCombined sources1
Modified residuei445PhosphothreonineBy similarity1
Modified residuei474PhosphoserineBy similarity1
Modified residuei487PhosphoserineCombined sources1
Modified residuei490PhosphoserineBy similarity1
Modified residuei491PhosphoserineBy similarity1
Modified residuei497PhosphoserineCombined sources1
Modified residuei624PhosphoserineBy similarity1
Modified residuei625PhosphoserineCombined sources1
Modified residuei628PhosphoserineBy similarity1
Modified residuei629PhosphoserineCombined sources1
Modified residuei872PhosphoserineBy similarity1
Modified residuei879PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ80X50.
PaxDbiQ80X50.
PeptideAtlasiQ80X50.
PRIDEiQ80X50.

PTM databases

iPTMnetiQ80X50.
PhosphoSitePlusiQ80X50.

Expressioni

Gene expression databases

BgeeiENSMUSG00000042520.
CleanExiMM_UBAP2L.
ExpressionAtlasiQ80X50. baseline and differential.
GenevisibleiQ80X50. MM.

Interactioni

Subunit structurei

Interacts with BMI1. Part of a complex consisting of UBAP2L, BMI1 and RNF2.By similarity

Protein-protein interaction databases

BioGridi216707. 3 interactors.
IntActiQ80X50. 1 interactor.
MINTiMINT-1870293.
STRINGi10090.ENSMUSP00000066138.

Structurei

Secondary structure

11107
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi28 – 32Combined sources5
Helixi33 – 44Combined sources12
Helixi48 – 60Combined sources13
Helixi65 – 75Combined sources11
Helixi79 – 87Combined sources9
Beta strandi90 – 92Combined sources3
Beta strandi105 – 109Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WJ7NMR-A19-109[»]
ProteinModelPortaliQ80X50.
SMRiQ80X50.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ80X50.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini49 – 89UBAPROSITE-ProRule annotationAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi124 – 190Arg/Gly-richAdd BLAST67
Compositional biasi469 – 472Poly-Pro4
Compositional biasi473 – 799Ser/Thr-richAdd BLAST327

Sequence similaritiesi

Contains 1 UBA domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
GeneTreeiENSGT00390000003453.
HOVERGENiHBG058387.
InParanoidiQ80X50.
OMAiAITQPAS.
OrthoDBiEOG091G0GRY.
PhylomeDBiQ80X50.
TreeFamiTF328468.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80X50-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMTSVGTNRA RGNWEQPQNQ NQTQHKQRPQ ATAEQIRLAQ MISDHNDADF
60 70 80 90 100
EEKVKQLIDI TGKNQDECVI ALHDCNGDVN RAINVLLEGN PDTHSWEMVG
110 120 130 140 150
KKKGVSGQKD GGQTESNEEG KENRDRDRDY SRRRGGPPRR GRGASRGREF
160 170 180 190 200
RGQENGLDGT KSGGPSGRGT DRGRRGRGRG RGSSGRRGGR FSAQGMGTFN
210 220 230 240 250
PADYAEPANT DDNYGNSSGN TWNNTGHFEP DDGTRLDFIG VEGSNYPRKF
260 270 280 290 300
ETAPGAWRTA TEEWGTEDWN EDLSETKIFT ASNVSSVPLP AENVTITAGQ
310 320 330 340 350
RIDLAVLLGK TPSSMENDSS NLDPSQAPSL AQPLVFSNSK QNAISQPASG
360 370 380 390 400
STFSHHSMVS MLGKGFGDVG EAKGGSTTGS QFLEQFKTAQ ALAQLAAQHS
410 420 430 440 450
QSGSTTTSSW DMGSTTQSPS LVQYDLKSAN DSTVHSPFTK RQAFTPSSTM
460 470 480 490 500
MEVFLQEKPP AVATSTAAPP PPSSPLPSKS TSAPQMSPGS SDNQSSSPQP
510 520 530 540 550
AQQKLKQQKK KTSLTSKIPA LAVEMPGSAD ISGLNLQFGA LQFGSEPVLS
560 570 580 590 600
DYESTPTTSA SSSQAPSSLY TSTASESSST VSSNQSQESG YQSGPIQSTT
610 620 630 640 650
YTSQNNAQGP LYEQRSTQTR RYPSSISSSP QKDLTQAKNG FSSVQATQLQ
660 670 680 690 700
TTQSVEGATG SAVKSESPST SSIPSLNETV PAASLLTTAN QHSSSLSGLS
710 720 730 740 750
HTEEIPNTTT TQHSSALSTQ QNTLSSSTSS GRTSTSTLLH TSVESEANLH
760 770 780 790 800
SSSSTFSTTS STVSAPPPVV SVSSSLNSGS SLGLSLGSNS TVTASTRSSV
810 820 830 840 850
ATTSGKAPPN LPPGVPPLLP NPYIMAPGLL HAYPPQVYGY DDLQMLQTRF
860 870 880 890 900
PLDYYSIPFP TPTTPLTGRD GSLASNPYSG DLTKFGRGDA SSPAPATTLA
910 920 930 940 950
QPQQNQTQTH HTTQQTFLNP ALPPGYSYTS LPYYTGVPGL PSTFQYGPAV
960 970 980 990 1000
FPVAPTSSKQ HGVNVSVNAS ATPFQQPSGY GSHGYNTGVS VTSSNTGVPD
1010 1020 1030 1040 1050
ISGSVYSKTQ QSFEKQGFHS GTPAASFNLP SALGSGGPIN PATAAAYPPA
1060 1070 1080 1090 1100
PFMHILTPHQ QPHSQILHHH LQQDGQTGSG QRSQTSSIPQ KPQTNKSAYN

SYSWGAN
Length:1,107
Mass (Da):116,799
Last modified:June 1, 2003 - v1
Checksum:iF4A4FB502B619C51
GO
Isoform 2 (identifier: Q80X50-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-150: F → CMHGALSKPAVV
     989-1107: VSVTSSNTGV...AYNSYSWGAN → RKYPPPYKHFWTAES

Show »
Length:1,014
Mass (Da):107,242
Checksum:i7672DF250DB63179
GO
Isoform 3 (identifier: Q80X50-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     235-255: RLDFIGVEGSNYPRKFETAPG → S
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → DILTLVDDQLGE

Show »
Length:1,068
Mass (Da):112,549
Checksum:i3645335AD2E03879
GO
Isoform 4 (identifier: Q80X50-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1077-1107: TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN → LPYLQMILCCQRQQEEQDILTLVDDQLGE

Show »
Length:1,105
Mass (Da):116,903
Checksum:i3DD82C85DE1B188A
GO
Isoform 5 (identifier: Q80X50-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-255: G → GMIHPG

Show »
Length:1,112
Mass (Da):117,335
Checksum:i3713A6AA077BD17B
GO

Sequence cautioni

The sequence BAC37777 differs from that shown. Reason: Frameshift at positions 444, 462 and 476.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti303D → G in BAC33295 (PubMed:16141072).Curated1
Sequence conflicti1010Missing in AAH23906 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti374G → S in strain: FVB/N. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019418150F → CMHGALSKPAVV in isoform 2. 1 Publication1
Alternative sequenceiVSP_019419235 – 255RLDFI…ETAPG → S in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_019420255G → GMIHPG in isoform 5. 1 Publication1
Alternative sequenceiVSP_019421989 – 1107VSVTS…SWGAN → RKYPPPYKHFWTAES in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_0194221077 – 1107TGSGQ…SWGAN → DILTLVDDQLGE in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0194231077 – 1107TGSGQ…SWGAN → LPYLQMILCCQRQQEEQDIL TLVDDQLGE in isoform 4. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014274 mRNA. Translation: BAB29236.1.
AK048286 mRNA. Translation: BAC33295.1.
AK079895 mRNA. Translation: BAC37777.1. Frameshift.
AK088702 mRNA. Translation: BAC40514.1.
BC023906 mRNA. Translation: AAH23906.1.
BC029075 mRNA. Translation: AAH29075.1.
BC050910 mRNA. Translation: AAH50910.1.
CCDSiCCDS38498.1. [Q80X50-4]
CCDS50965.1. [Q80X50-2]
CCDS50966.1. [Q80X50-5]
CCDS79960.1. [Q80X50-1]
RefSeqiNP_001159455.1. NM_001165983.1. [Q80X50-5]
NP_001159456.1. NM_001165984.1. [Q80X50-1]
NP_001159457.1. NM_001165985.1. [Q80X50-2]
NP_001159458.1. NM_001165986.1. [Q80X50-2]
NP_082751.1. NM_028475.2. [Q80X50-4]
XP_006502235.1. XM_006502172.2. [Q80X50-5]
UniGeneiMm.25610.
Mm.441742.

Genome annotation databases

EnsembliENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520. [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520. [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520. [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520. [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520. [Q80X50-2]
GeneIDi74383.
KEGGimmu:74383.
UCSCiuc008qal.2. mouse. [Q80X50-4]
uc008qam.2. mouse. [Q80X50-3]
uc008qao.2. mouse. [Q80X50-1]
uc008qap.2. mouse. [Q80X50-5]
uc008qas.2. mouse. [Q80X50-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK014274 mRNA. Translation: BAB29236.1.
AK048286 mRNA. Translation: BAC33295.1.
AK079895 mRNA. Translation: BAC37777.1. Frameshift.
AK088702 mRNA. Translation: BAC40514.1.
BC023906 mRNA. Translation: AAH23906.1.
BC029075 mRNA. Translation: AAH29075.1.
BC050910 mRNA. Translation: AAH50910.1.
CCDSiCCDS38498.1. [Q80X50-4]
CCDS50965.1. [Q80X50-2]
CCDS50966.1. [Q80X50-5]
CCDS79960.1. [Q80X50-1]
RefSeqiNP_001159455.1. NM_001165983.1. [Q80X50-5]
NP_001159456.1. NM_001165984.1. [Q80X50-1]
NP_001159457.1. NM_001165985.1. [Q80X50-2]
NP_001159458.1. NM_001165986.1. [Q80X50-2]
NP_082751.1. NM_028475.2. [Q80X50-4]
XP_006502235.1. XM_006502172.2. [Q80X50-5]
UniGeneiMm.25610.
Mm.441742.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WJ7NMR-A19-109[»]
ProteinModelPortaliQ80X50.
SMRiQ80X50.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi216707. 3 interactors.
IntActiQ80X50. 1 interactor.
MINTiMINT-1870293.
STRINGi10090.ENSMUSP00000066138.

PTM databases

iPTMnetiQ80X50.
PhosphoSitePlusiQ80X50.

Proteomic databases

EPDiQ80X50.
PaxDbiQ80X50.
PeptideAtlasiQ80X50.
PRIDEiQ80X50.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029553; ENSMUSP00000029553; ENSMUSG00000042520. [Q80X50-4]
ENSMUST00000064639; ENSMUSP00000066138; ENSMUSG00000042520. [Q80X50-5]
ENSMUST00000195995; ENSMUSP00000143638; ENSMUSG00000042520. [Q80X50-2]
ENSMUST00000196843; ENSMUSP00000143459; ENSMUSG00000042520. [Q80X50-1]
ENSMUST00000199834; ENSMUSP00000143254; ENSMUSG00000042520. [Q80X50-2]
GeneIDi74383.
KEGGimmu:74383.
UCSCiuc008qal.2. mouse. [Q80X50-4]
uc008qam.2. mouse. [Q80X50-3]
uc008qao.2. mouse. [Q80X50-1]
uc008qap.2. mouse. [Q80X50-5]
uc008qas.2. mouse. [Q80X50-2]

Organism-specific databases

CTDi9898.
MGIiMGI:1921633. Ubap2l.

Phylogenomic databases

eggNOGiENOG410IGWX. Eukaryota.
ENOG4110RI8. LUCA.
GeneTreeiENSGT00390000003453.
HOVERGENiHBG058387.
InParanoidiQ80X50.
OMAiAITQPAS.
OrthoDBiEOG091G0GRY.
PhylomeDBiQ80X50.
TreeFamiTF328468.

Miscellaneous databases

ChiTaRSiUbap2l. mouse.
EvolutionaryTraceiQ80X50.
PROiQ80X50.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042520.
CleanExiMM_UBAP2L.
ExpressionAtlasiQ80X50. baseline and differential.
GenevisibleiQ80X50. MM.

Family and domain databases

InterProiIPR022166. DUF3697_Uba2.
IPR015940. UBA.
IPR009060. UBA-like.
[Graphical view]
PfamiPF12478. DUF3697. 1 hit.
[Graphical view]
SMARTiSM00165. UBA. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS50030. UBA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUBP2L_MOUSE
AccessioniPrimary (citable) accession number: Q80X50
Secondary accession number(s): Q8BIT6
, Q8BIW4, Q8BJ01, Q8CIG7, Q8K102, Q9CRT6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: June 1, 2003
Last modified: November 30, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.