Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and BTB domain-containing protein 24

Gene

Zbtb24

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in BMP2-induced transcription.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi159 – 17113A.T hookAdd
BLAST
Zinc fingeri293 – 31523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri321 – 34323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri349 – 37123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri377 – 39923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri405 – 42723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri433 – 45523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri461 – 48323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri489 – 51123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB

GO - Biological processi

  • hematopoietic progenitor cell differentiation Source: MGI
  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and BTB domain-containing protein 24
Alternative name(s):
Bone morphogenetic protein-induced factor 1
Brain-specific protein 1
Zinc finger protein 450
Gene namesi
Name:Zbtb24
Synonyms:Bif1, Bsg1, Znf450
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:3039618. Zbtb24.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 710710Zinc finger and BTB domain-containing protein 24PRO_0000047735Add
BLAST

Proteomic databases

EPDiQ80X44.
MaxQBiQ80X44.
PaxDbiQ80X44.
PRIDEiQ80X44.

PTM databases

PhosphoSiteiQ80X44.

Expressioni

Tissue specificityi

Widely expressed. Highest level in liver, testis and kidney.1 Publication

Inductioni

By BMP2 in fibroblast, myoblast and preosteoblast cell lines.1 Publication

Gene expression databases

BgeeiQ80X44.
CleanExiMM_ZBTB24.
GenevisibleiQ80X44. MM.

Interactioni

Protein-protein interaction databases

BioGridi234478. 2 interactions.
IntActiQ80X44. 1 interaction.
MINTiMINT-5188934.
STRINGi10090.ENSMUSP00000079592.

Structurei

3D structure databases

ProteinModelPortaliQ80X44.
SMRiQ80X44. Positions 19-124, 295-515.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini37 – 10367BTBPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 A.T hook DNA-binding domain.Curated
Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 8 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri293 – 31523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri321 – 34323C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri349 – 37123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri377 – 39923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri405 – 42723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri433 – 45523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri461 – 48323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri489 – 51123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129870.
HOGENOMiHOG000155762.
HOVERGENiHBG053990.
InParanoidiQ80X44.
KOiK10503.
OMAiEFIYTGY.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ80X44.
TreeFamiTF332049.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00651. BTB. 1 hit.
PF00096. zf-C2H2. 1 hit.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 8 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80X44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADTTPEPCG QLMVHSDTHS DTVLASLEDQ RKKGFLCDIT LIVENVHFRA
60 70 80 90 100
HKALLAASSE YFSMMFAEEG EIGQSIYMLE GMVADTFGIL LEFIYTGYLH
110 120 130 140 150
ASEKTTEQIL ATAQFLKVYD LVKAYADFQD NHSAPKPPAL NCTGTPVVVI
160 170 180 190 200
SNKKNDPLKR KRGRPRKANG LQEGRSELAA EGELQLRVNN SVQNRQNFVF
210 220 230 240 250
KEEDSVKLSE QTPEDKESEP AGEPGSVEEV PAEKDENFDP KAGDGQESQS
260 270 280 290 300
RCSRRRIRRS VKLKDYKLLG DEDDQSTAKR LCGRKKRSSG PEARCKDCDR
310 320 330 340 350
VFKYSHFLAI HQRRHTGERP FKCNECGKGF AQKHSLQVHT RMHTGERPYT
360 370 380 390 400
CTVCGKALTT KHSLLEHMSL HSGQKSFTCD QCGKYFSQKR QLKSHYRVHT
410 420 430 440 450
GHSLPECSHC HRKFMDVSQL KKHLRTHTGE KPFTCEICGK SFTAKSSLQT
460 470 480 490 500
HIRIHRGEKP YSCSICGKCF SDSSAKRRHC ILHTGKKPFS CPECGLQFAR
510 520 530 540 550
LDNLKAHLKI HSKEKHTADS SSVSGSNVDE GRNILQLQPY QLSTSGEQEI
560 570 580 590 600
QLLVTDSVHN INFMPGPSQG VSIVAAESPQ SMATDPAANI TLLTQQPEQL
610 620 630 640 650
QGLILSAQQE QAEHIQSLSV IGGQMESSQT EPVHVITLSK ETLEHLHAHQ
660 670 680 690 700
EQTTSSVPAA DTGARATPVP STRPGAELTQ APLAVPLDPS PGATVAGWPF
710
GPSSYRSLKM
Length:710
Mass (Da):78,751
Last modified:June 1, 2003 - v1
Checksum:iBB0533A274AFFF2D
GO
Isoform 2 (identifier: Q80X44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-454: HSLPECSHCH...KSSLQTHIRI → TIPIRPLTTRMQPLPPKVYGRVPAEEAPADT

Note: No experimental confirmation available.
Show »
Length:688
Mass (Da):76,046
Checksum:i9B1A54292C2C0B1F
GO
Isoform 3 (identifier: Q80X44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     318-354: ERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVC → NFDFQTWCDWLGSLELWLGRLCCFYMVDMAIKPSCCV
     355-710: Missing.

Show »
Length:354
Mass (Da):40,007
Checksum:i951524B28D7727FD
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei318 – 35437ERPFK…TCTVC → NFDFQTWCDWLGSLELWLGR LCCFYMVDMAIKPSCCV in isoform 3. 1 PublicationVSP_016223Add
BLAST
Alternative sequencei355 – 710356Missing in isoform 3. 1 PublicationVSP_016224Add
BLAST
Alternative sequencei402 – 45453HSLPE…THIRI → TIPIRPLTTRMQPLPPKVYG RVPAEEAPADT in isoform 2. 1 PublicationVSP_016225Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF263010 mRNA. Translation: AAK91811.2.
AY210402 mRNA. Translation: AAO42998.1.
AY210403 Genomic DNA. Translation: AAO42999.1.
AK054097 mRNA. Translation: BAE20695.1.
AK146986 mRNA. Translation: BAE27589.1.
BC050933 mRNA. Translation: AAH50933.1.
BC055367 mRNA. Translation: AAH55367.1.
CCDSiCCDS23804.1. [Q80X44-1]
RefSeqiNP_001264158.1. NM_001277229.1. [Q80X44-2]
NP_001264159.1. NM_001277230.1. [Q80X44-3]
NP_700447.2. NM_153398.3. [Q80X44-1]
UniGeneiMm.258475.

Genome annotation databases

EnsembliENSMUST00000080771; ENSMUSP00000079592; ENSMUSG00000019826. [Q80X44-1]
GeneIDi268294.
KEGGimmu:268294.
UCSCiuc007exl.2. mouse. [Q80X44-3]
uc007exm.2. mouse. [Q80X44-1]
uc011xdb.2. mouse. [Q80X44-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF263010 mRNA. Translation: AAK91811.2.
AY210402 mRNA. Translation: AAO42998.1.
AY210403 Genomic DNA. Translation: AAO42999.1.
AK054097 mRNA. Translation: BAE20695.1.
AK146986 mRNA. Translation: BAE27589.1.
BC050933 mRNA. Translation: AAH50933.1.
BC055367 mRNA. Translation: AAH55367.1.
CCDSiCCDS23804.1. [Q80X44-1]
RefSeqiNP_001264158.1. NM_001277229.1. [Q80X44-2]
NP_001264159.1. NM_001277230.1. [Q80X44-3]
NP_700447.2. NM_153398.3. [Q80X44-1]
UniGeneiMm.258475.

3D structure databases

ProteinModelPortaliQ80X44.
SMRiQ80X44. Positions 19-124, 295-515.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi234478. 2 interactions.
IntActiQ80X44. 1 interaction.
MINTiMINT-5188934.
STRINGi10090.ENSMUSP00000079592.

PTM databases

PhosphoSiteiQ80X44.

Proteomic databases

EPDiQ80X44.
MaxQBiQ80X44.
PaxDbiQ80X44.
PRIDEiQ80X44.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000080771; ENSMUSP00000079592; ENSMUSG00000019826. [Q80X44-1]
GeneIDi268294.
KEGGimmu:268294.
UCSCiuc007exl.2. mouse. [Q80X44-3]
uc007exm.2. mouse. [Q80X44-1]
uc011xdb.2. mouse. [Q80X44-2]

Organism-specific databases

CTDi9841.
MGIiMGI:3039618. Zbtb24.

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129870.
HOGENOMiHOG000155762.
HOVERGENiHBG053990.
InParanoidiQ80X44.
KOiK10503.
OMAiEFIYTGY.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ80X44.
TreeFamiTF332049.

Miscellaneous databases

NextBioi392224.
PROiQ80X44.
SOURCEiSearch...

Gene expression databases

BgeeiQ80X44.
CleanExiMM_ZBTB24.
GenevisibleiQ80X44. MM.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00651. BTB. 1 hit.
PF00096. zf-C2H2. 1 hit.
PF13912. zf-C2H2_6. 1 hit.
[Graphical view]
SMARTiSM00225. BTB. 1 hit.
SM00355. ZnF_C2H2. 8 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Bone morphogenetic protein-2 induces expression of murine zinc finger transcription factor ZNF450."
    Edgar A.J., Dover S.L., Lodrick M.N., McKay I.J., Hughes F.J., Turner W.
    J. Cell. Biochem. 94:202-215(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, INDUCTION.
  2. "Cloning and characterization of a novel mouse gene BSG1 cDNA specifically expressed in brain and hippocampus."
    Chen W., Ci H., Wu T., Liang Y., Shimizu K., Li Y.-P.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Amnion and Oviduct.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C3H/He and C57BL/6.
    Tissue: Brain and Osteoblast.
  5. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 441-453 AND 506-515, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6J.
    Tissue: Brain.

Entry informationi

Entry nameiZBT24_MOUSE
AccessioniPrimary (citable) accession number: Q80X44
Secondary accession number(s): Q3UIB7, Q7TPC4, Q8CJC9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2005
Last sequence update: June 1, 2003
Last modified: May 11, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.