Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP domain and FG repeat-containing protein 2

Gene

Agfg2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri47 – 70C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP domain and FG repeat-containing protein 2
Alternative name(s):
HIV-1 Rev-binding protein-like protein
Rev/Rex activation domain-binding protein related
Short name:
RAB-R
Gene namesi
Name:Agfg2
Synonyms:Hrbl, Rabr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2443267 Agfg2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002048291 – 479Arf-GAP domain and FG repeat-containing protein 2Add BLAST479

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei174N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ80WC7
PRIDEiQ80WC7

PTM databases

iPTMnetiQ80WC7
PhosphoSitePlusiQ80WC7

Expressioni

Gene expression databases

BgeeiENSMUSG00000029722
ExpressionAtlasiQ80WC7 baseline and differential
GenevisibleiQ80WC7 MM

Interactioni

Subunit structurei

Interacts with EPS15R.1 Publication

Protein-protein interaction databases

BioGridi231167, 1 interactor
STRINGi10090.ENSMUSP00000031736

Structurei

3D structure databases

ProteinModelPortaliQ80WC7
SMRiQ80WC7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 153Arf-GAPPROSITE-ProRule annotationAdd BLAST127

Domaini

Contains FG repeats and 4 N-P-F repeats.

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri47 – 70C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0702 Eukaryota
ENOG41122WA LUCA
GeneTreeiENSGT00560000077249
HOGENOMiHOG000253009
HOVERGENiHBG006551
InParanoidiQ80WC7
PhylomeDBiQ80WC7
TreeFamiTF325357

Family and domain databases

Gene3Di3.30.40.160, 1 hit
InterProiView protein in InterPro
IPR037278 ARFGAP/RecO
IPR001164 ArfGAP_dom
IPR038508 ArfGAP_dom_sf
PfamiView protein in Pfam
PF01412 ArfGap, 1 hit
PRINTSiPR00405 REVINTRACTNG
SMARTiView protein in SMART
SM00105 ArfGap, 1 hit
SUPFAMiSSF57863 SSF57863, 1 hit
PROSITEiView protein in PROSITE
PS50115 ARFGAP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80WC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVMAAKKGPG PGGGVGGSKA EAEAASEVWC RRVRELGGCS QAGNRHCFEC
60 70 80 90 100
AQRGVTYVDI TVGSFVCTTC SGLLRGLNPP HRVKSISMTT FTEPEVLFLQ
110 120 130 140 150
SRGNEVCRKI WLGLFDARTS LIPDSRDPQK VKEFLQEKYE KKRWYVPPEQ
160 170 180 190 200
VKGPSYSKGS VSATPVQGSV PEGKPIRTLL GDPVPSLSDP ASTSSQPGSQ
210 220 230 240 250
SQARSSSQAR SSQPPSHSST KKASTDLLAD IGGDPFAAPQ VVPAFASFPG
260 270 280 290 300
FGVGQTPAHG GFANFDAFSS SPSSSTFGSL PPSVQAPFQA QPTPAGSGQM
310 320 330 340 350
SAFGVAPLAA ASQPNNLADV GGLLGPRMAA GGLPGSVFGM PSQVPALQSA
360 370 380 390 400
VPGVSGSGGL PFGAYTNPFA TPAQAQLPST NPFQPNGLAS GPGFGMSSVR
410 420 430 440 450
PGLLQPVPPS GAFASPFSAP VFPTQAGLAD QQNGSSFGDL GTSKLGQRPL
460 470
SQPAGISTNP FMTGSSAFAS KPPTTNPFL
Length:479
Mass (Da):48,968
Last modified:June 1, 2003 - v1
Checksum:iBE299F70C28D6457
GO
Isoform 2 (identifier: Q80WC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     253-289: VGQTPAHGGFANFDAFSSSPSSSTFGSLPPSVQAPFQ → GKYYPGAGTRLRRICITAKTSLVHRGLTFLCGWGQGA
     290-479: Missing.

Show »
Length:289
Mass (Da):30,735
Checksum:i0BE1EF4FB343774B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010669253 – 289VGQTP…QAPFQ → GKYYPGAGTRLRRICITAKT SLVHRGLTFLCGWGQGA in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_010670290 – 479Missing in isoform 2. 1 PublicationAdd BLAST190

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC003330 mRNA Translation: AAH03330.1
BC046788 mRNA Translation: AAH46788.1
AK050881 mRNA Translation: BAC34441.1
CCDSiCCDS19774.1 [Q80WC7-1]
RefSeqiNP_835456.1, NM_178162.3 [Q80WC7-1]
UniGeneiMm.260869

Genome annotation databases

EnsembliENSMUST00000031736; ENSMUSP00000031736; ENSMUSG00000029722 [Q80WC7-1]
GeneIDi231801
KEGGimmu:231801
UCSCiuc009adl.2 mouse [Q80WC7-1]
uc009ado.3 mouse [Q80WC7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAGFG2_MOUSE
AccessioniPrimary (citable) accession number: Q80WC7
Secondary accession number(s): Q8BKS5, Q99J67
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 1, 2003
Last modified: March 28, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health