Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arf-GAP domain and FG repeat-containing protein 2

Gene

Agfg2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri47 – 7024C4-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Arf-GAP domain and FG repeat-containing protein 2
Alternative name(s):
HIV-1 Rev-binding protein-like protein
Rev/Rex activation domain-binding protein related
Short name:
RAB-R
Gene namesi
Name:Agfg2
Synonyms:Hrbl, Rabr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:2443267. Agfg2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 479479Arf-GAP domain and FG repeat-containing protein 2PRO_0000204829Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei174 – 1741N6-acetyllysineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ80WC7.
MaxQBiQ80WC7.
PaxDbiQ80WC7.
PRIDEiQ80WC7.

PTM databases

iPTMnetiQ80WC7.
PhosphoSiteiQ80WC7.

Expressioni

Gene expression databases

BgeeiQ80WC7.
ExpressionAtlasiQ80WC7. baseline and differential.
GenevisibleiQ80WC7. MM.

Interactioni

Subunit structurei

Interacts with EPS15R.1 Publication

Protein-protein interaction databases

BioGridi231167. 1 interaction.
STRINGi10090.ENSMUSP00000031736.

Structurei

3D structure databases

ProteinModelPortaliQ80WC7.
SMRiQ80WC7. Positions 44-155.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 153127Arf-GAPPROSITE-ProRule annotationAdd
BLAST

Domaini

Contains FG repeats and 4 N-P-F repeats.

Sequence similaritiesi

Contains 1 Arf-GAP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri47 – 7024C4-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0702. Eukaryota.
ENOG41122WA. LUCA.
GeneTreeiENSGT00560000077249.
HOGENOMiHOG000253009.
HOVERGENiHBG006551.
InParanoidiQ80WC7.
OrthoDBiEOG7W9RW0.
PhylomeDBiQ80WC7.
TreeFamiTF325357.

Family and domain databases

InterProiIPR001164. ArfGAP.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
[Graphical view]
PROSITEiPS50115. ARFGAP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80WC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVMAAKKGPG PGGGVGGSKA EAEAASEVWC RRVRELGGCS QAGNRHCFEC
60 70 80 90 100
AQRGVTYVDI TVGSFVCTTC SGLLRGLNPP HRVKSISMTT FTEPEVLFLQ
110 120 130 140 150
SRGNEVCRKI WLGLFDARTS LIPDSRDPQK VKEFLQEKYE KKRWYVPPEQ
160 170 180 190 200
VKGPSYSKGS VSATPVQGSV PEGKPIRTLL GDPVPSLSDP ASTSSQPGSQ
210 220 230 240 250
SQARSSSQAR SSQPPSHSST KKASTDLLAD IGGDPFAAPQ VVPAFASFPG
260 270 280 290 300
FGVGQTPAHG GFANFDAFSS SPSSSTFGSL PPSVQAPFQA QPTPAGSGQM
310 320 330 340 350
SAFGVAPLAA ASQPNNLADV GGLLGPRMAA GGLPGSVFGM PSQVPALQSA
360 370 380 390 400
VPGVSGSGGL PFGAYTNPFA TPAQAQLPST NPFQPNGLAS GPGFGMSSVR
410 420 430 440 450
PGLLQPVPPS GAFASPFSAP VFPTQAGLAD QQNGSSFGDL GTSKLGQRPL
460 470
SQPAGISTNP FMTGSSAFAS KPPTTNPFL
Length:479
Mass (Da):48,968
Last modified:June 1, 2003 - v1
Checksum:iBE299F70C28D6457
GO
Isoform 2 (identifier: Q80WC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     253-289: VGQTPAHGGFANFDAFSSSPSSSTFGSLPPSVQAPFQ → GKYYPGAGTRLRRICITAKTSLVHRGLTFLCGWGQGA
     290-479: Missing.

Show »
Length:289
Mass (Da):30,735
Checksum:i0BE1EF4FB343774B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei253 – 28937VGQTP…QAPFQ → GKYYPGAGTRLRRICITAKT SLVHRGLTFLCGWGQGA in isoform 2. 1 PublicationVSP_010669Add
BLAST
Alternative sequencei290 – 479190Missing in isoform 2. 1 PublicationVSP_010670Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC003330 mRNA. Translation: AAH03330.1.
BC046788 mRNA. Translation: AAH46788.1.
AK050881 mRNA. Translation: BAC34441.1.
CCDSiCCDS19774.1. [Q80WC7-1]
RefSeqiNP_835456.1. NM_178162.3. [Q80WC7-1]
UniGeneiMm.260869.

Genome annotation databases

EnsembliENSMUST00000031736; ENSMUSP00000031736; ENSMUSG00000029722. [Q80WC7-1]
GeneIDi231801.
KEGGimmu:231801.
UCSCiuc009adl.2. mouse. [Q80WC7-1]
uc009ado.3. mouse. [Q80WC7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC003330 mRNA. Translation: AAH03330.1.
BC046788 mRNA. Translation: AAH46788.1.
AK050881 mRNA. Translation: BAC34441.1.
CCDSiCCDS19774.1. [Q80WC7-1]
RefSeqiNP_835456.1. NM_178162.3. [Q80WC7-1]
UniGeneiMm.260869.

3D structure databases

ProteinModelPortaliQ80WC7.
SMRiQ80WC7. Positions 44-155.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231167. 1 interaction.
STRINGi10090.ENSMUSP00000031736.

PTM databases

iPTMnetiQ80WC7.
PhosphoSiteiQ80WC7.

Proteomic databases

EPDiQ80WC7.
MaxQBiQ80WC7.
PaxDbiQ80WC7.
PRIDEiQ80WC7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031736; ENSMUSP00000031736; ENSMUSG00000029722. [Q80WC7-1]
GeneIDi231801.
KEGGimmu:231801.
UCSCiuc009adl.2. mouse. [Q80WC7-1]
uc009ado.3. mouse. [Q80WC7-2]

Organism-specific databases

CTDi3268.
MGIiMGI:2443267. Agfg2.

Phylogenomic databases

eggNOGiKOG0702. Eukaryota.
ENOG41122WA. LUCA.
GeneTreeiENSGT00560000077249.
HOGENOMiHOG000253009.
HOVERGENiHBG006551.
InParanoidiQ80WC7.
OrthoDBiEOG7W9RW0.
PhylomeDBiQ80WC7.
TreeFamiTF325357.

Miscellaneous databases

PROiQ80WC7.
SOURCEiSearch...

Gene expression databases

BgeeiQ80WC7.
ExpressionAtlasiQ80WC7. baseline and differential.
GenevisibleiQ80WC7. MM.

Family and domain databases

InterProiIPR001164. ArfGAP.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
[Graphical view]
PROSITEiPS50115. ARFGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Brain and Mammary tumor.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 247-479 (ISOFORM 1).
    Strain: C57BL/6J.
  3. "Eps15R is a tyrosine kinase substrate with characteristics of a docking protein possibly involved in coated pits-mediated internalization."
    Coda L., Salcini A.E., Confalonieri S., Pelicci G., Sorkina T., Sorkin A., Pelicci P.G., Di Fiore P.P.
    J. Biol. Chem. 273:3003-3012(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH EPS15R.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Liver, Lung, Spleen and Testis.

Entry informationi

Entry nameiAGFG2_MOUSE
AccessioniPrimary (citable) accession number: Q80WC7
Secondary accession number(s): Q8BKS5, Q99J67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 1, 2003
Last modified: June 8, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.