Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hydrocephalus-inducing protein

Gene

Hydin

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for ciliary motility.1 Publication

GO - Biological processi

  • axonemal central apparatus assembly Source: MGI
  • cilium movement Source: MGI
  • epithelial cell development Source: MGI
  • multicellular organism development Source: MGI
  • trachea development Source: MGI
  • ventricular system development Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Hydrocephalus-inducing protein
Alternative name(s):
Protein Hy-3
Gene namesi
Name:Hydin
Synonyms:Hy3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2389007. Hydin.

Subcellular locationi

GO - Cellular componenti

  • axonemal central pair projection Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell projection

Pathology & Biotechi

Involvement in diseasei

Defects in Hydin are the cause of spontaneous hydrocephalus 3, a lethal communicating hydrocephalus with perinatal onset. There is lethality in the first weeks of life because of hydrocephalus caused by abnormal ependymal ciliary motility. Cilia are unable to bend normally, ciliary beat frequency is reduced, and the cilia tend to stall. As a result, these cilia are incapable of generating fluid flow. Similar defects are observed for cilia in trachea. Mice do not exhibit randomization of left-right body asymmetry or situs inversus.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 51545154Hydrocephalus-inducing proteinPRO_0000284845Add
BLAST

Proteomic databases

MaxQBiQ80W93.
PaxDbiQ80W93.
PRIDEiQ80W93.

PTM databases

iPTMnetiQ80W93.
PhosphoSiteiQ80W93.

Expressioni

Tissue specificityi

Expressed in brain and testis. Expressed in ciliated epithelial cells lining bronchi and oviduct, and in spermatocytes.1 Publication

Developmental stagei

At E15, expressed in developing choroid plexus. At P0, brain expression is limited to the ciliated ependymal cells.1 Publication

Gene expression databases

BgeeiQ80W93.
CleanExiMM_HYDIN.
GenevisibleiQ80W93. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046204.

Structurei

3D structure databases

ProteinModelPortaliQ80W93.
SMRiQ80W93. Positions 228-342, 504-609.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1948 – 197730Sequence analysisAdd
BLAST
Coiled coili2308 – 2444137Sequence analysisAdd
BLAST
Coiled coili2543 – 258846Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IE17. Eukaryota.
ENOG410XT7J. LUCA.
GeneTreeiENSGT00610000086095.
HOGENOMiHOG000293333.
HOVERGENiHBG099337.
InParanoidiQ80W93.
KOiK17570.
OMAiGHCDIIA.
OrthoDBiEOG7TMZR1.
PhylomeDBiQ80W93.
TreeFamiTF328687.

Family and domain databases

Gene3Di2.60.40.360. 2 hits.
3.40.50.300. 3 hits.
InterProiIPR031549. ASH.
IPR033305. Hydin.
IPR000535. MSP_dom.
IPR027417. P-loop_NTPase.
IPR008962. PapD-like.
[Graphical view]
PANTHERiPTHR23053:SF16. PTHR23053:SF16. 8 hits.
PfamiPF15780. ASH. 1 hit.
PF00635. Motile_Sperm. 1 hit.
[Graphical view]
SUPFAMiSSF49354. SSF49354. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80W93-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLKIKCVAN YIKEKIPNVL FLCDPEARLQ QLTASVPLCE QRKYFKQTNK
60 70 80 90 100
RLEESMGAMH RKMAKVISGL QSKVLPPMSP KVVTEEEVNR MLTPSEFLKE
110 120 130 140 150
MSLTTEQKLA STRIICRPQI TELLDMGETT HQKFSRVDLD QALFQPFPSE
160 170 180 190 200
IIFQNYSPCE VYEVPLVLRN NDKIPRMVKV VEESSPYFKI ISPKDIGHKV
210 220 230 240 250
APGVPSVFRI LFTPEENKDY AHMLTCITER EKFIVPVKAR GARAILDFPD
260 270 280 290 300
ELNFSTCPVK YNTQKVLLVR NIGNKDSMFH LKTRSPYSVE PTGGILNVGE
310 320 330 340 350
SMQLEVDFEP QTVGSHDGKL IVTYDTGEMV FVCLYGVAID VNIRLDKNSL
360 370 380 390 400
IMEKTYISLA NQRSITIHNR TNIIAHFQWK VFATEEEEDK EKYKICDGLN
410 420 430 440 450
KEEKQETSMI LEDSVLDPSL RERLSIISRT FENQRKLVQG DSMLFLDHVF
460 470 480 490 500
TIEPPEGDVW PNSSAEITVY FNPLEAKLYQ QTVYCDISGR EIRLPLRIRG
510 520 530 540 550
EGMGPKLHFN FELLDIGKVF IGSAHCYEAI LSNKGSIDAL FNVIPPTSAL
560 570 580 590 600
GACFVFNPKE GIIEPSGVQA VQISFSSTIL GYFEEEFLID VNGSPEPVKM
610 620 630 640 650
TIRGCVIGPT FHFNVPALNF GNVSYGFPHT LMCSLNNTSL VPMTFKLRVR
660 670 680 690 700
GDGEGMSSIP SYSQESDSKQ WSGINTEMPT TKPKEFTISP NSGTIRAQGF
710 720 730 740 750
TAIKVTLCSN TVQKYELALV VDVEGIGEEV LALLITARCV VPKLQLVTTE
760 770 780 790 800
VDFGRCFLKY PYEKTIQLVN HDDLPGCYKV LPQLYENSPP VLLSSPSPCG
810 820 830 840 850
VISPHSTVSI PLALETQVIG AHRSIVYISV FGSQEAPLAC NIQSIGEGPV
860 870 880 890 900
IFIHPTQIDF GNIYVLKDTS RILQLSNQSF IPAVFRVRMA NKKSLWTVKP
910 920 930 940 950
SEGAVPAEDD IPLTLTANLD DIVTFKDTVI LEIKHSNTYR IPIQATGIGS
960 970 980 990 1000
TIVSDKPFAP ELNLGAHFSL DTHYYRFKLT NKGRRVQQLF WMNDDFRPKE
1010 1020 1030 1040 1050
KQSKKEPGKK GSTSSSRRQS KASQEPTDNG NPVFQLYPVR MELYPGQTID
1060 1070 1080 1090 1100
VILEGYSATP KKVKEKLVCQ AIVGTQKGKS LLMSVNIICE FIAPIIQLSA
1110 1120 1130 1140 1150
KQLLYRLEKK PNSNLESDYQ SLVIKNITTL PVNMLLSTTR PFFICETDKS
1160 1170 1180 1190 1200
LLPATPKPIK LEVDEEKHLL IKFDPSYRND LNNWVAEEVL SIKYLEHPQV
1210 1220 1230 1240 1250
DNLGLRAEVH YPNLSFEVMD IDFGCILNDT EVIRYIMITN CSPLVVKFRW
1260 1270 1280 1290 1300
FFLVDEEENQ IRFAPCMKPY SAFLSQMESI AATSVTASSL AAPHTVEYTE
1310 1320 1330 1340 1350
MDFSDSIKTI LMDDEAGPEE IKKPATSTMV SEAIKYSSAG TERSQSQPDY
1360 1370 1380 1390 1400
PECMWIYEQD EMLSIGIEEV FDILPLYGVL RPYSSHQISF TFYGHCDIIA
1410 1420 1430 1440 1450
RAKALCEVEG GPTYEVLLKG EASLVNYSFD TKDINYGLQL FDHVTEREIT
1460 1470 1480 1490 1500
LKNTGKVGFE FNVLSNYRSS QRNLLPGVPL ILPLSGFIQS NKEQVLKVYY
1510 1520 1530 1540 1550
LPGIPEVFQR NFQIQIAHLV PENITLYGEG IFPRISLDLH RNLQGNEKYE
1560 1570 1580 1590 1600
HFLEQAKKNV EKEYTKYEAV DQYEVMAEEL PEEETAEISA HVQMEVERLI
1610 1620 1630 1640 1650
VQDYALEHQR SISNNTEDIY FSQRSCRKLT KVQLPEYILD FGYIVLGDVR
1660 1670 1680 1690 1700
THIVKITNTS HFPVSFHAEK QVLHETGFST ELDRVKNLPY YETETFEVRC
1710 1720 1730 1740 1750
DPQGANLPVG NKEVILPIKV YGGPTIHLCL QATVIIPSMT LSCNKIEFAT
1760 1770 1780 1790 1800
IQCGQCMVET IQLSNHLQVP CEWFVHTPKS TNKLDKHMPK YLRRKLQAEM
1810 1820 1830 1840 1850
IPKSRIFEIQ PTSGILDPGE RANVQVKFMP KEEKLYSQSL LFQIGQSSQK
1860 1870 1880 1890 1900
LTLLAQGQGL EPRLEFSPSV LELGPLLPFA SGDEAEVIVR NPCNFPIEFY
1910 1920 1930 1940 1950
SLEFDQQYLL EEKMLRQLKG YDSYNTLLLP PRNPGEKLPP EVYDYFKEMK
1960 1970 1980 1990 2000
KSKEEHMKAK YMENLENEEE EMNTSDQGTT STKRTSISRG ISVTSNLEER
2010 2020 2030 2040 2050
HLTIEAKNYL DEDDYEESLE KLTFQTDKMQ STDSHSVEEV GEVESNPVSK
2060 2070 2080 2090 2100
AIARHLGIDI SAEGRLAKNR KGIAIIVHGT PLSGKTANAI SMAKFYNAAC
2110 2120 2130 2140 2150
LNIDSIVLEA LSDTNNILGI RARELCIRAA IEQSMREAEE SAHESSMTQN
2160 2170 2180 2190 2200
TVVPARLSTE NLGRFTSELT LITQEYKVPK TVRGSVMLPK GKADSHFTGS
2210 2220 2230 2240 2250
QKQHHQHQSE TPQVQISSSP LLPGPTHRRL SVSASIGGET GLMSCVLPDD
2260 2270 2280 2290 2300
LLIQILAERI QLSNCFRGVV FDGLDTLFAR NAPSALHCLL KAIGSREHIY
2310 2320 2330 2340 2350
VINMSQDYVV MKAQEKAKKE QEENKRKEAL AKEKERLQTL DEDEYDALTA
2360 2370 2380 2390 2400
EEKVAFDRDV RQALRERKKR ELERLAKEMQ EKKLQQELER QKEEDELKRK
2410 2420 2430 2440 2450
VKRPKAGPAA KEEPPLKKAQ GATNKQLAAV AKIELKMESI ERKVSVREHA
2460 2470 2480 2490 2500
TLEETTRKKK AMTEYPLLIP ISQEQEDSEG DFLKDSDKNL AQKFKIYDMC
2510 2520 2530 2540 2550
LKDVQNILMY WDRKQGMMVP HTGTDEMSHE ADDQRQAPSG GGGRKGRKDR
2560 2570 2580 2590 2600
ERERLEKERA EKERLEREKA ERERLEKLKA LEERSDVEGE GEEEHEGKKD
2610 2620 2630 2640 2650
LGVPFINIQS PDFEGVSWKQ ALESDKLPKG DQILDILGLG SSGPPIPPPV
2660 2670 2680 2690 2700
LFSIISYPAK RQSLVATEIL KHFVFVIPPN DDIPLMDEKK DPEGDSDIFL
2710 2720 2730 2740 2750
NTIITKAQEE QPSPPKGSKQ KLKDKPEQVR ETQKEKRRTY SSRKGLPGGT
2760 2770 2780 2790 2800
SGSIVPMSDI DQNSFDGEHS QEKFIRLNHF RWIVPPNGEV TLRVHFSSLD
2810 2820 2830 2840 2850
VGNYDQTFNF ELLGTRRQYQ LYCRGVCTYP YICRDPKVVF SQRKKDMKLK
2860 2870 2880 2890 2900
EVVVKKYVVS MEKFYFGPLL CGKSRDKYKS SLFPGNMETL TILNDSPMVV
2910 2920 2930 2940 2950
EAYFCFQHDI KASTYFLEPV NMTLKPNEKQ ALNVWAYPTA VGIFEDSIVC
2960 2970 2980 2990 3000
CIKENPEPAI FKLSCQGIRP EIEVEPRQLH FDRLLLHRKE TKIVILRNVT
3010 3020 3030 3040 3050
PLPVAWRISN LEHLGEDFTV SMMQGTMLPK GEYGLQVHFQ PSKPVNIKKA
3060 3070 3080 3090 3100
IRIEVLDAEN LVGVVQIENI LIFAESYDIA LDITFPKGAE GGLDFGTLRV
3110 3120 3130 3140 3150
MEEVKQTLQL KNRGKYEIIF SFTVDTLGVL PTNLSSMISV QPKRGTLASI
3160 3170 3180 3190 3200
DKPTTVQVFF RARKEVKIDC QPILRCQIIE PTLPEGEIIA SIPIKFSVNA
3210 3220 3230 3240 3250
VYSKFTISPS SIINFGALIC GTRKSITFTI ENQGIIDFKY ALYRLTGESP
3260 3270 3280 3290 3300
ILQKKITSHM RHGRTRESES FYKPGATKMA KFSDTVQKDT NIANQARFTH
3310 3320 3330 3340 3350
GMFTVYPGFG SIPSGGQQVI TIECFADPVG RCEEFLAIDI SDRDPRENPA
3360 3370 3380 3390 3400
GIPYTLLAEA CLPAFVTDNN ILIFEEHQIC TSPNLYHILQ TIQSGGLFVE
3410 3420 3430 3440 3450
DENKFIFCNV LVGHQAKARF KISNVGKISC DINIVIKPIS NKPANRITDT
3460 3470 3480 3490 3500
FDVEPSKMCI GSRSHAFVTV LFTPQTMQTY QCIFEATLDG LPSNIARSRG
3510 3520 3530 3540 3550
LVFDIVGEGT LPRVTVIRPT LYNQHGNPLL LFKRLLLGHS EKLPLILKNN
3560 3570 3580 3590 3600
GTIPAQLHVD LRDQLGVFSL KGRPTTSYIY IMEENKPNEK VKKAHTASLV
3610 3620 3630 3640 3650
VSPGDTAEFD VFFHSNKIGR MTGTIHLSVI NNQYEETMIH LVGESYEDDI
3660 3670 3680 3690 3700
TLDNIHGLIS STSQESSDKS EVIEIAEEST MEDLVTAALM EHIQFGYCHI
3710 3720 3730 3740 3750
GISYNVSFTI TNHSQVNVIR FEWPLLATLS FSPQIGHLHP GCSKDVVVTL
3760 3770 3780 3790 3800
KSESPITLKK MCVKCKLSKI MFQLPVDQVP DWDDRMRTVK WVDAPRNTPL
3810 3820 3830 3840 3850
TLNTKRKVIE MDPEPAHSVV EENYRELRIQ FSANVDFASY QCETTEVFFK
3860 3870 3880 3890 3900
ETLVYQTRVF EFDLVNTGQV LLEFCWISEE ASKAVSFAMP ERQGSSQKEL
3910 3920 3930 3940 3950
SQGSGSSLDS ALDRWTEASP SPFSVEPPSG VVPVGKTQKL KVKFSPMDIG
3960 3970 3980 3990 4000
EFESSLYCQI PNLPLGEQGP ILITKGRSVL PFCHFDLKES DYISGHRRNP
4010 4020 4030 4040 4050
ELRGPGAGPL EPNTRVIEFT SVGIGGKNVQ TFTILNPTNS TYSFCWTSEE
4060 4070 4080 4090 4100
TESLQHPPAF VCLTEKGIIH PEKKAEIIFQ FLPAHLDITE EFWTFSIPEH
4110 4120 4130 4140 4150
NISVPFLLVG KTTDPLISLD KSHLNFSSLL IGREARETVK IINKEEQGFN
4160 4170 4180 4190 4200
FAFQDNSRYS EGFNNSLIVC PMEGWIPPLS RFPVDIFFTP KQEGDVNFNL
4210 4220 4230 4240 4250
ICNIKKKAHP LTLNVKAEGY TMNAEVKCRD RMGTTILLTS TQVNTINFYE
4260 4270 4280 4290 4300
VELNECVQCE FSFINTGKFN FSYQAELSGP KLLLQYLDFT PTDSSVDVGQ
4310 4320 4330 4340 4350
SEPANLSFQP YQKCVLKGLE LKIKISHGPT FVCNILGCAV SPAVHFSFTS
4360 4370 4380 4390 4400
HNFGTCFIYQ AGMPPYKQIL VVTNKEETSM SLDCLYTNTP HIEVNFNVDV
4410 4420 4430 4440 4450
IKPGKTLEIP ITFYPREAIS YRELIPFEIN GLSQQTVEIK GKGTEMKLLV
4460 4470 4480 4490 4500
LDPANRIVKL GAVLPGQVVR KTVSLVNNSL AQLTFNHSVL FSIPELQEAK
4510 4520 4530 4540 4550
VITLEPFHTI TMKPKEVCKL EITFAPKKRV PPFSEEVFME WMGLLRPLFL
4560 4570 4580 4590 4600
LSGCCQALEI SLDQEHLPFG PVVYQTQATR RILIMNTGDV GARFKWDVKK
4610 4620 4630 4640 4650
LKPHFSISPE EGYIISGTEV ALEVTYHPTE IGKESLYKNI LCFIQGGNPL
4660 4670 4680 4690 4700
CLTLSGTCVG PPVVKEVVNF NCQVRSRHTQ TILLSNRSNQ TWNLHPIFEG
4710 4720 4730 4740 4750
EHWEGPEFIT LEAHQQNKPY EITYKPRTMN LENRKHQGTL FFPLPDGTGW
4760 4770 4780 4790 4800
LYALHGTAEL PKAVANIYRE VPCKTPYTEL LPISNWLNKP QRFRVIVEIL
4810 4820 4830 4840 4850
KPEKTDLSVT LKGLDYIDVL SGSKKDYKLN FFSYKEGLYT AKVIFRNEVT
4860 4870 4880 4890 4900
NEFLYYTVSF RVTPSGIIKT IQMTSPVRQS VSASIKLENP LPYSVTFSTE
4910 4920 4930 4940 4950
CKLSDISLPS QFAVPPNSEG TFSFEFQPLK AGELCGRLTL HNSDLGYYQY
4960 4970 4980 4990 5000
ELALKALPAP PEKPVHFQTV LGSSQSILAK FTNYTRLKTE YYCKTDCSDF
5010 5020 5030 5040 5050
HTEKVINAAP GAQGGTEVSV EVFFEPSHLG ETKGILCLSS LIGGEYIIPL
5060 5070 5080 5090 5100
FGIALPPKPQ GPFLIRAGYN IIIPFKNVFL HATSFSFIVE NPAFSIRAAE
5110 5120 5130 5140 5150
TVRPKKINNI TVYFEGNPSG SKTPITSKLI VTCPQCEGTE SGIKWVYYLK

GITP
Length:5,154
Mass (Da):581,523
Last modified:April 5, 2011 - v2
Checksum:i64BD17692EAFD2BA
GO
Isoform 2 (identifier: Q80W93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1333-1333: A → V
     1334-5154: Missing.

Note: No experimental confirmation available.
Show »
Length:1,333
Mass (Da):149,957
Checksum:i61CF56D6A1E4E16F
GO
Isoform 3 (identifier: Q80W93-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MTLKIKCVANYIKEKIPNVLFLCDPEARLQQLTASVPL → MDSAVQQKVARKKCRD
     489-501: GREIRLPLRIRGE → VRSTEDGILGPLQ
     502-5154: Missing.

Note: No experimental confirmation available.
Show »
Length:479
Mass (Da):54,897
Checksum:i4F8BD2891282B69E
GO

Sequence cautioni

The sequence AAO44953.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC26807.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BB664150 differs from that shown.Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti97 – 971F → S in BB641870 (PubMed:16141072).Curated
Sequence conflicti107 – 1071Q → H in BB641870 (PubMed:16141072).Curated
Sequence conflicti190 – 1901I → M in BAE25238 (PubMed:16141072).Curated
Sequence conflicti1264 – 12641A → T in BAE25238 (PubMed:16141072).Curated
Sequence conflicti4370 – 43701L → F in AAH80316 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MTLKI…ASVPL → MDSAVQQKVARKKCRD in isoform 3. 1 PublicationVSP_040915Add
BLAST
Alternative sequencei489 – 50113GREIR…RIRGE → VRSTEDGILGPLQ in isoform 3. 1 PublicationVSP_040916Add
BLAST
Alternative sequencei502 – 51544653Missing in isoform 3. 1 PublicationVSP_040917Add
BLAST
Alternative sequencei1333 – 13331A → V in isoform 2. 1 PublicationVSP_024701
Alternative sequencei1334 – 51543821Missing in isoform 2. 1 PublicationVSP_024702Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY173049 mRNA. Translation: AAO44953.1. Different initiation.
AK030144 mRNA. Translation: BAC26807.1. Different initiation.
AK043971 mRNA. Translation: BAC31720.1.
AK142981 mRNA. Translation: BAE25238.1.
BB641870 mRNA. No translation available.
BB664150 mRNA. No translation available.
BC080316 mRNA. Translation: AAH80316.1.
CCDSiCCDS40476.1. [Q80W93-1]
RefSeqiNP_766504.3. NM_172916.2. [Q80W93-1]
UniGeneiMm.444803.
Mm.488112.

Genome annotation databases

EnsembliENSMUST00000043141; ENSMUSP00000046204; ENSMUSG00000059854. [Q80W93-1]
GeneIDi244653.
KEGGimmu:244653.
UCSCiuc009nkq.1. mouse. [Q80W93-3]
uc009nkr.1. mouse. [Q80W93-2]
uc009nks.1. mouse. [Q80W93-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY173049 mRNA. Translation: AAO44953.1. Different initiation.
AK030144 mRNA. Translation: BAC26807.1. Different initiation.
AK043971 mRNA. Translation: BAC31720.1.
AK142981 mRNA. Translation: BAE25238.1.
BB641870 mRNA. No translation available.
BB664150 mRNA. No translation available.
BC080316 mRNA. Translation: AAH80316.1.
CCDSiCCDS40476.1. [Q80W93-1]
RefSeqiNP_766504.3. NM_172916.2. [Q80W93-1]
UniGeneiMm.444803.
Mm.488112.

3D structure databases

ProteinModelPortaliQ80W93.
SMRiQ80W93. Positions 228-342, 504-609.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046204.

PTM databases

iPTMnetiQ80W93.
PhosphoSiteiQ80W93.

Proteomic databases

MaxQBiQ80W93.
PaxDbiQ80W93.
PRIDEiQ80W93.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043141; ENSMUSP00000046204; ENSMUSG00000059854. [Q80W93-1]
GeneIDi244653.
KEGGimmu:244653.
UCSCiuc009nkq.1. mouse. [Q80W93-3]
uc009nkr.1. mouse. [Q80W93-2]
uc009nks.1. mouse. [Q80W93-1]

Organism-specific databases

CTDi54768.
MGIiMGI:2389007. Hydin.

Phylogenomic databases

eggNOGiENOG410IE17. Eukaryota.
ENOG410XT7J. LUCA.
GeneTreeiENSGT00610000086095.
HOGENOMiHOG000293333.
HOVERGENiHBG099337.
InParanoidiQ80W93.
KOiK17570.
OMAiGHCDIIA.
OrthoDBiEOG7TMZR1.
PhylomeDBiQ80W93.
TreeFamiTF328687.

Miscellaneous databases

ChiTaRSiHydin. mouse.
PROiQ80W93.
SOURCEiSearch...

Gene expression databases

BgeeiQ80W93.
CleanExiMM_HYDIN.
GenevisibleiQ80W93. MM.

Family and domain databases

Gene3Di2.60.40.360. 2 hits.
3.40.50.300. 3 hits.
InterProiIPR031549. ASH.
IPR033305. Hydin.
IPR000535. MSP_dom.
IPR027417. P-loop_NTPase.
IPR008962. PapD-like.
[Graphical view]
PANTHERiPTHR23053:SF16. PTHR23053:SF16. 8 hits.
PfamiPF15780. ASH. 1 hit.
PF00635. Motile_Sperm. 1 hit.
[Graphical view]
SUPFAMiSSF49354. SSF49354. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Congenital hydrocephalus in hy3 mice is caused by a frameshift mutation in Hydin, a large novel gene."
    Davy B.E., Robinson M.L.
    Hum. Mol. Genet. 12:1163-1170(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DISEASE, DEVELOPMENTAL STAGE.
    Strain: C57BL/6J.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-113 AND 4193-5154 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain cortex, Lung and Testis.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4014-5154 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "Hydin seek: finding a function in ciliary motility."
    Smith E.F.
    J. Cell Biol. 176:403-404(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  5. Cited for: FUNCTION, DISEASE.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Testis.

Entry informationi

Entry nameiHYDIN_MOUSE
AccessioniPrimary (citable) accession number: Q80W93
Secondary accession number(s): Q3UQ06
, Q68ED1, Q8BRL9, Q8CDF4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 5, 2011
Last modified: June 8, 2016
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-56 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.