Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heparan-sulfate 6-O-sulfotransferase 2

Gene

Hs6st2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Catalytic activityi

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

GO - Molecular functioni

  • heparan sulfate 6-O-sulfotransferase activity Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

ReactomeiR-MMU-2022928. HS-GAG biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
Short name:
HS6ST-2
Short name:
mHS6ST-2
Gene namesi
Name:Hs6st2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1354959. Hs6st2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4CytoplasmicSequence analysis4
Transmembranei5 – 27Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini28 – 612LumenalSequence analysisAdd BLAST585

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001908061 – 612Heparan-sulfate 6-O-sulfotransferase 2Add BLAST612

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi209N-linked (GlcNAc...)Sequence analysis1
Glycosylationi404N-linked (GlcNAc...)Sequence analysis1
Glycosylationi460N-linked (GlcNAc...)Sequence analysis1
Glycosylationi546N-linked (GlcNAc...)Sequence analysis1
Glycosylationi558N-linked (GlcNAc...)Sequence analysis1
Glycosylationi562N-linked (GlcNAc...)Sequence analysis1
Glycosylationi574N-linked (GlcNAc...)Sequence analysis1
Glycosylationi599N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PeptideAtlasiQ80UW0.
PRIDEiQ80UW0.

PTM databases

PhosphoSitePlusiQ80UW0.

Expressioni

Gene expression databases

BgeeiENSMUSG00000062184.
CleanExiMM_HS6ST2.
GenevisibleiQ80UW0. MM.

Structurei

3D structure databases

ProteinModelPortaliQ80UW0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni236 – 2425'-phosphosulfate-bindingSequence analysis7
Regioni325 – 3333'-phosphate bindingSequence analysis9

Sequence similaritiesi

Belongs to the sulfotransferase 6 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000013468.
HOGENOMiHOG000007772.
HOVERGENiHBG083012.
InParanoidiQ80UW0.
KOiK08102.
OMAiLRPSRWR.
OrthoDBiEOG091G08UD.
TreeFamiTF312835.

Family and domain databases

InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12812. PTHR12812. 2 hits.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80UW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALPAFAARA LGPPLQPEQG APARTTCPRR HSRVEAELAA SRPGSVAASV
60 70 80 90 100
RAGPPRGVSL GFNSPPLQDK PPKAFSSLAG ALRAPLFALL PRGRRRRMHD
110 120 130 140 150
LRRRWDLGSL CRALLTRGLA AVGHSLKHVL SAIFSKIFGP LASVGNMDEK
160 170 180 190 200
SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES
210 220 230 240 250
SARFVPRYNF SRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI
260 270 280 290 300
QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV
310 320 330 340 350
PAVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV
360 370 380 390 400
CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV
410 420 430 440 450
GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM
460 470 480 490 500
NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ
510 520 530 540 550
FMRQKEHQDA RRKRQEQRKF LKGRFLQTHF QSQSQGQSQS QSPGQNLSQN
560 570 580 590 600
PNPNPNQNLT QNLSHNLTPS SNPNSTQREN RGSQKQGSGQ GQGDSGTSNG
610
TNDYIGSVET WR
Length:612
Mass (Da):69,198
Last modified:January 9, 2007 - v3
Checksum:i12551E4408936D8D
GO
Isoform 2 (identifier: Q80UW0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:466
Mass (Da):53,737
Checksum:i12304F0E8EDF93CE
GO
Isoform 3 (identifier: Q80UW0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     316-316: R → RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGK

Note: No experimental confirmation available.
Show »
Length:652
Mass (Da):73,553
Checksum:i4E3F3D370B4E3FC3
GO

Sequence cautioni

The sequence BAC34950 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti419E → D in BAE42608 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0158481 – 146Missing in isoform 2. 2 PublicationsAdd BLAST146
Alternative sequenceiVSP_015849316R → RWRIFQILDGTSKDRWGSSN FNSGANSPSSTKPRSTSKSG K in isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK052348 mRNA. Translation: BAC34950.1. Different initiation.
AK171680 mRNA. Translation: BAE42608.1.
AL671918, AL672057 Genomic DNA. Translation: CAM16284.1.
AL672057, AL671918 Genomic DNA. Translation: CAM21295.1.
AL672099 Genomic DNA. No translation available.
BC047151 mRNA. Translation: AAH47151.1.
BC063327 mRNA. Translation: AAH63327.1.
AB024565 mRNA. Translation: BAA89247.1.
CCDSiCCDS40970.1. [Q80UW0-3]
CCDS72379.1. [Q80UW0-1]
RefSeqiNP_001070670.1. NM_001077202.2. [Q80UW0-3]
NP_001277396.1. NM_001290467.1. [Q80UW0-1]
NP_001277397.1. NM_001290468.1.
NP_056634.3. NM_015819.4. [Q80UW0-2]
XP_006541581.1. XM_006541518.2.
XP_006541582.1. XM_006541519.3.
UniGeneiMm.252561.

Genome annotation databases

EnsembliENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. [Q80UW0-3]
ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. [Q80UW0-1]
GeneIDi50786.
KEGGimmu:50786.
UCSCiuc009tdw.2. mouse. [Q80UW0-1]
uc009tdx.2. mouse. [Q80UW0-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK052348 mRNA. Translation: BAC34950.1. Different initiation.
AK171680 mRNA. Translation: BAE42608.1.
AL671918, AL672057 Genomic DNA. Translation: CAM16284.1.
AL672057, AL671918 Genomic DNA. Translation: CAM21295.1.
AL672099 Genomic DNA. No translation available.
BC047151 mRNA. Translation: AAH47151.1.
BC063327 mRNA. Translation: AAH63327.1.
AB024565 mRNA. Translation: BAA89247.1.
CCDSiCCDS40970.1. [Q80UW0-3]
CCDS72379.1. [Q80UW0-1]
RefSeqiNP_001070670.1. NM_001077202.2. [Q80UW0-3]
NP_001277396.1. NM_001290467.1. [Q80UW0-1]
NP_001277397.1. NM_001290468.1.
NP_056634.3. NM_015819.4. [Q80UW0-2]
XP_006541581.1. XM_006541518.2.
XP_006541582.1. XM_006541519.3.
UniGeneiMm.252561.

3D structure databases

ProteinModelPortaliQ80UW0.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSitePlusiQ80UW0.

Proteomic databases

PeptideAtlasiQ80UW0.
PRIDEiQ80UW0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. [Q80UW0-3]
ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. [Q80UW0-1]
GeneIDi50786.
KEGGimmu:50786.
UCSCiuc009tdw.2. mouse. [Q80UW0-1]
uc009tdx.2. mouse. [Q80UW0-3]

Organism-specific databases

CTDi90161.
MGIiMGI:1354959. Hs6st2.

Phylogenomic databases

GeneTreeiENSGT00390000013468.
HOGENOMiHOG000007772.
HOVERGENiHBG083012.
InParanoidiQ80UW0.
KOiK08102.
OMAiLRPSRWR.
OrthoDBiEOG091G08UD.
TreeFamiTF312835.

Enzyme and pathway databases

ReactomeiR-MMU-2022928. HS-GAG biosynthesis.

Miscellaneous databases

PROiQ80UW0.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000062184.
CleanExiMM_HS6ST2.
GenevisibleiQ80UW0. MM.

Family and domain databases

InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12812. PTHR12812. 2 hits.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiH6ST2_MOUSE
AccessioniPrimary (citable) accession number: Q80UW0
Secondary accession number(s): A2AEM4
, Q3TAR0, Q6P4N9, Q8C785, Q9QYK6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: January 9, 2007
Last modified: November 2, 2016
This is version 106 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.