SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q80UW0

- H6ST2_MOUSE

UniProt

Q80UW0 - H6ST2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Heparan-sulfate 6-O-sulfotransferase 2
Gene
Hs6st2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Catalytic activityi

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

GO - Molecular functioni

  1. heparan sulfate 6-O-sulfotransferase activity Source: MGI

GO - Biological processi

  1. heparan sulfate proteoglycan biosynthetic process, enzymatic modification Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

ReactomeiREACT_198654. HS-GAG biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
Short name:
HS6ST-2
Short name:
mHS6ST-2
Gene namesi
Name:Hs6st2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:1354959. Hs6st2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 44Cytoplasmic Reviewed prediction
Transmembranei5 – 2723Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini28 – 612585Lumenal Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 612612Heparan-sulfate 6-O-sulfotransferase 2
PRO_0000190806Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi209 – 2091N-linked (GlcNAc...) Reviewed prediction
Glycosylationi404 – 4041N-linked (GlcNAc...) Reviewed prediction
Glycosylationi460 – 4601N-linked (GlcNAc...) Reviewed prediction
Glycosylationi546 – 5461N-linked (GlcNAc...) Reviewed prediction
Glycosylationi558 – 5581N-linked (GlcNAc...) Reviewed prediction
Glycosylationi562 – 5621N-linked (GlcNAc...) Reviewed prediction
Glycosylationi574 – 5741N-linked (GlcNAc...) Reviewed prediction
Glycosylationi599 – 5991N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ80UW0.
PRIDEiQ80UW0.

PTM databases

PhosphoSiteiQ80UW0.

Expressioni

Gene expression databases

BgeeiQ80UW0.
CleanExiMM_HS6ST2.
GenevestigatoriQ80UW0.

Structurei

3D structure databases

ProteinModelPortaliQ80UW0.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni236 – 24275'-phosphosulfate-binding Reviewed prediction
Regioni325 – 33393'-phosphate binding Reviewed prediction

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302961.
GeneTreeiENSGT00390000013468.
HOGENOMiHOG000007772.
HOVERGENiHBG083012.
KOiK08102.
OMAiLRPSRWR.
OrthoDBiEOG75MVW3.
TreeFamiTF312835.

Family and domain databases

InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12812. PTHR12812. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q80UW0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALPAFAARA LGPPLQPEQG APARTTCPRR HSRVEAELAA SRPGSVAASV    50
RAGPPRGVSL GFNSPPLQDK PPKAFSSLAG ALRAPLFALL PRGRRRRMHD 100
LRRRWDLGSL CRALLTRGLA AVGHSLKHVL SAIFSKIFGP LASVGNMDEK 150
SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES 200
SARFVPRYNF SRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI 250
QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV 300
PAVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV 350
CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV 400
GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM 450
NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ 500
FMRQKEHQDA RRKRQEQRKF LKGRFLQTHF QSQSQGQSQS QSPGQNLSQN 550
PNPNPNQNLT QNLSHNLTPS SNPNSTQREN RGSQKQGSGQ GQGDSGTSNG 600
TNDYIGSVET WR 612
Length:612
Mass (Da):69,198
Last modified:January 9, 2007 - v3
Checksum:i12551E4408936D8D
GO
Isoform 2 (identifier: Q80UW0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:466
Mass (Da):53,737
Checksum:i12304F0E8EDF93CE
GO
Isoform 3 (identifier: Q80UW0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     316-316: R → RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGK

Note: No experimental confirmation available.

Show »
Length:652
Mass (Da):73,553
Checksum:i4E3F3D370B4E3FC3
GO

Sequence cautioni

The sequence BAC34950.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 146146Missing in isoform 2.
VSP_015848Add
BLAST
Alternative sequencei316 – 3161R → RWRIFQILDGTSKDRWGSSN FNSGANSPSSTKPRSTSKSG K in isoform 3.
VSP_015849

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti419 – 4191E → D in BAE42608. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK052348 mRNA. Translation: BAC34950.1. Different initiation.
AK171680 mRNA. Translation: BAE42608.1.
AL671918, AL672057 Genomic DNA. Translation: CAM16284.1.
AL672057, AL671918 Genomic DNA. Translation: CAM21295.1.
AL672099 Genomic DNA. No translation available.
BC047151 mRNA. Translation: AAH47151.1.
BC063327 mRNA. Translation: AAH63327.1.
AB024565 mRNA. Translation: BAA89247.1.
CCDSiCCDS40970.1. [Q80UW0-3]
CCDS72379.1. [Q80UW0-1]
RefSeqiNP_001070670.1. NM_001077202.2. [Q80UW0-3]
NP_001277396.1. NM_001290467.1. [Q80UW0-1]
NP_001277397.1. NM_001290468.1.
NP_056634.3. NM_015819.4. [Q80UW0-2]
XP_006541581.1. XM_006541518.1.
XP_006541582.1. XM_006541519.1.
UniGeneiMm.252561.

Genome annotation databases

EnsembliENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. [Q80UW0-3]
ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. [Q80UW0-1]
GeneIDi50786.
KEGGimmu:50786.
UCSCiuc009tdw.1. mouse. [Q80UW0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK052348 mRNA. Translation: BAC34950.1 . Different initiation.
AK171680 mRNA. Translation: BAE42608.1 .
AL671918 , AL672057 Genomic DNA. Translation: CAM16284.1 .
AL672057 , AL671918 Genomic DNA. Translation: CAM21295.1 .
AL672099 Genomic DNA. No translation available.
BC047151 mRNA. Translation: AAH47151.1 .
BC063327 mRNA. Translation: AAH63327.1 .
AB024565 mRNA. Translation: BAA89247.1 .
CCDSi CCDS40970.1. [Q80UW0-3 ]
CCDS72379.1. [Q80UW0-1 ]
RefSeqi NP_001070670.1. NM_001077202.2. [Q80UW0-3 ]
NP_001277396.1. NM_001290467.1. [Q80UW0-1 ]
NP_001277397.1. NM_001290468.1.
NP_056634.3. NM_015819.4. [Q80UW0-2 ]
XP_006541581.1. XM_006541518.1.
XP_006541582.1. XM_006541519.1.
UniGenei Mm.252561.

3D structure databases

ProteinModelPortali Q80UW0.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q80UW0.

Proteomic databases

PaxDbi Q80UW0.
PRIDEi Q80UW0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000088172 ; ENSMUSP00000085497 ; ENSMUSG00000062184 . [Q80UW0-3 ]
ENSMUST00000114871 ; ENSMUSP00000110521 ; ENSMUSG00000062184 . [Q80UW0-1 ]
GeneIDi 50786.
KEGGi mmu:50786.
UCSCi uc009tdw.1. mouse. [Q80UW0-1 ]

Organism-specific databases

CTDi 90161.
MGIi MGI:1354959. Hs6st2.

Phylogenomic databases

eggNOGi NOG302961.
GeneTreei ENSGT00390000013468.
HOGENOMi HOG000007772.
HOVERGENi HBG083012.
KOi K08102.
OMAi LRPSRWR.
OrthoDBi EOG75MVW3.
TreeFami TF312835.

Enzyme and pathway databases

Reactomei REACT_198654. HS-GAG biosynthesis.

Miscellaneous databases

NextBioi 307753.
PROi Q80UW0.
SOURCEi Search...

Gene expression databases

Bgeei Q80UW0.
CleanExi MM_HS6ST2.
Genevestigatori Q80UW0.

Family and domain databases

InterProi IPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view ]
PANTHERi PTHR12812. PTHR12812. 1 hit.
Pfami PF03567. Sulfotransfer_2. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-409 (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Heart.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 78-612 (ISOFORM 1).
    Strain: FVB/N-3.
    Tissue: Brain and Mammary tumor.
  4. "The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase having different specificities for hexuronic acid adjacent to the targeted N-sulfoglucosamine."
    Habuchi H., Tanaka M., Habuchi O., Yoshida K., Suzuki H., Ban K., Kimata K.
    J. Biol. Chem. 275:2859-2868(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-612 (ISOFORM 3).
    Tissue: Brain.

Entry informationi

Entry nameiH6ST2_MOUSE
AccessioniPrimary (citable) accession number: Q80UW0
Secondary accession number(s): A2AEM4
, Q3TAR0, Q6P4N9, Q8C785, Q9QYK6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: January 9, 2007
Last modified: September 3, 2014
This is version 90 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi