Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q80UW0 (H6ST2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Heparan-sulfate 6-O-sulfotransferase 2

Short name=HS6ST-2
Short name=mHS6ST-2
EC=2.8.2.-
Gene names
Name:Hs6st2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length612 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Catalytic activity

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

Subcellular location

Membrane; Single-pass type II membrane protein Potential.

Sequence similarities

Belongs to the sulfotransferase 6 family.

Sequence caution

The sequence BAC34950.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q80UW0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q80UW0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
Isoform 3 (identifier: Q80UW0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     316-316: R → RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 612612Heparan-sulfate 6-O-sulfotransferase 2
PRO_0000190806

Regions

Topological domain1 – 44Cytoplasmic Potential
Transmembrane5 – 2723Helical; Signal-anchor for type II membrane protein; Potential
Topological domain28 – 612585Lumenal Potential
Region236 – 24275'-phosphosulfate-binding Potential
Region325 – 33393'-phosphate binding Potential

Amino acid modifications

Glycosylation2091N-linked (GlcNAc...) Potential
Glycosylation4041N-linked (GlcNAc...) Potential
Glycosylation4601N-linked (GlcNAc...) Potential
Glycosylation5461N-linked (GlcNAc...) Potential
Glycosylation5581N-linked (GlcNAc...) Potential
Glycosylation5621N-linked (GlcNAc...) Potential
Glycosylation5741N-linked (GlcNAc...) Potential
Glycosylation5991N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 146146Missing in isoform 2.
VSP_015848
Alternative sequence3161R → RWRIFQILDGTSKDRWGSSN FNSGANSPSSTKPRSTSKSG K in isoform 3.
VSP_015849

Experimental info

Sequence conflict4191E → D in BAE42608. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 9, 2007. Version 3.
Checksum: 12551E4408936D8D

FASTA61269,198
        10         20         30         40         50         60 
MALPAFAARA LGPPLQPEQG APARTTCPRR HSRVEAELAA SRPGSVAASV RAGPPRGVSL 

        70         80         90        100        110        120 
GFNSPPLQDK PPKAFSSLAG ALRAPLFALL PRGRRRRMHD LRRRWDLGSL CRALLTRGLA 

       130        140        150        160        170        180 
AVGHSLKHVL SAIFSKIFGP LASVGNMDEK SNKLLLALVM LFLFAVIVLQ YVCPGTECQL 

       190        200        210        220        230        240 
LRLQAFSSPV PDPYRSEDES SARFVPRYNF SRGDLLRKVD FDIKGDDLIV FLHIQKTGGT 

       250        260        270        280        290        300 
TFGRHLVRNI QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV 

       310        320        330        340        350        360 
PAVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV CDGRPPTSEE 

       370        380        390        400        410        420 
LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV GCYNLSVMPE KQRNKVLLES 

       430        440        450        460        470        480 
AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM NFISPFTQYN TTRASSVEIN EEIQKRIEGL 

       490        500        510        520        530        540 
NFLDMELYSY AKDLFLQRYQ FMRQKEHQDA RRKRQEQRKF LKGRFLQTHF QSQSQGQSQS 

       550        560        570        580        590        600 
QSPGQNLSQN PNPNPNQNLT QNLSHNLTPS SNPNSTQREN RGSQKQGSGQ GQGDSGTSNG 

       610 
TNDYIGSVET WR 

« Hide

Isoform 2 [UniParc].

Checksum: 12304F0E8EDF93CE
Show »

FASTA46653,737
Isoform 3 [UniParc].

Checksum: 4E3F3D370B4E3FC3
Show »

FASTA65273,553

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-409 (ISOFORM 3).
Strain: C57BL/6J.
Tissue: Heart.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 78-612 (ISOFORM 1).
Strain: FVB/N-3.
Tissue: Brain and Mammary tumor.
[4]"The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase having different specificities for hexuronic acid adjacent to the targeted N-sulfoglucosamine."
Habuchi H., Tanaka M., Habuchi O., Yoshida K., Suzuki H., Ban K., Kimata K.
J. Biol. Chem. 275:2859-2868(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-612 (ISOFORM 3).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK052348 mRNA. Translation: BAC34950.1. Different initiation.
AK171680 mRNA. Translation: BAE42608.1.
AL671918, AL672057 Genomic DNA. Translation: CAM16284.1.
AL672057, AL671918 Genomic DNA. Translation: CAM21295.1.
AL672099 Genomic DNA. No translation available.
BC047151 mRNA. Translation: AAH47151.1.
BC063327 mRNA. Translation: AAH63327.1.
AB024565 mRNA. Translation: BAA89247.1.
RefSeqNP_001070670.1. NM_001077202.1.
NP_056634.3. NM_015819.3.
XP_006541580.1. XM_006541517.1.
XP_006541581.1. XM_006541518.1.
XP_006541582.1. XM_006541519.1.
UniGeneMm.252561.

3D structure databases

ProteinModelPortalQ80UW0.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ80UW0.

Proteomic databases

PaxDbQ80UW0.
PRIDEQ80UW0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. [Q80UW0-3]
ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. [Q80UW0-1]
GeneID50786.
KEGGmmu:50786.
UCSCuc009tdw.1. mouse. [Q80UW0-1]

Organism-specific databases

CTD90161.
MGIMGI:1354959. Hs6st2.

Phylogenomic databases

eggNOGNOG302961.
GeneTreeENSGT00390000013468.
HOGENOMHOG000007772.
HOVERGENHBG083012.
KOK08102.
OMALRPSRWR.
OrthoDBEOG75MVW3.
TreeFamTF312835.

Gene expression databases

BgeeQ80UW0.
CleanExMM_HS6ST2.
GenevestigatorQ80UW0.

Family and domain databases

InterProIPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERPTHR12812. PTHR12812. 1 hit.
PfamPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

NextBio307753.
PROQ80UW0.
SOURCESearch...

Entry information

Entry nameH6ST2_MOUSE
AccessionPrimary (citable) accession number: Q80UW0
Secondary accession number(s): A2AEM4 expand/collapse secondary AC list , Q3TAR0, Q6P4N9, Q8C785, Q9QYK6
Entry history
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: January 9, 2007
Last modified: April 16, 2014
This is version 86 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot