Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q80UW0

- H6ST2_MOUSE

UniProt

Q80UW0 - H6ST2_MOUSE

Protein

Heparan-sulfate 6-O-sulfotransferase 2

Gene

Hs6st2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 3 (09 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

    Catalytic activityi

    3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

    GO - Molecular functioni

    1. heparan sulfate 6-O-sulfotransferase activity Source: MGI

    GO - Biological processi

    1. heparan sulfate proteoglycan biosynthetic process, enzymatic modification Source: MGI

    Keywords - Molecular functioni

    Transferase

    Enzyme and pathway databases

    ReactomeiREACT_198654. HS-GAG biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
    Short name:
    HS6ST-2
    Short name:
    mHS6ST-2
    Gene namesi
    Name:Hs6st2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:1354959. Hs6st2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 612612Heparan-sulfate 6-O-sulfotransferase 2PRO_0000190806Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi209 – 2091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi404 – 4041N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi460 – 4601N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi546 – 5461N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi558 – 5581N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi562 – 5621N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi574 – 5741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi599 – 5991N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ80UW0.
    PRIDEiQ80UW0.

    PTM databases

    PhosphoSiteiQ80UW0.

    Expressioni

    Gene expression databases

    BgeeiQ80UW0.
    CleanExiMM_HS6ST2.
    GenevestigatoriQ80UW0.

    Structurei

    3D structure databases

    ProteinModelPortaliQ80UW0.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 44CytoplasmicSequence Analysis
    Topological domaini28 – 612585LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei5 – 2723Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni236 – 24275'-phosphosulfate-bindingSequence Analysis
    Regioni325 – 33393'-phosphate bindingSequence Analysis

    Sequence similaritiesi

    Belongs to the sulfotransferase 6 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG302961.
    GeneTreeiENSGT00390000013468.
    HOGENOMiHOG000007772.
    HOVERGENiHBG083012.
    KOiK08102.
    OMAiLRPSRWR.
    OrthoDBiEOG75MVW3.
    TreeFamiTF312835.

    Family and domain databases

    InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view]
    PANTHERiPTHR12812. PTHR12812. 1 hit.
    PfamiPF03567. Sulfotransfer_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q80UW0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALPAFAARA LGPPLQPEQG APARTTCPRR HSRVEAELAA SRPGSVAASV    50
    RAGPPRGVSL GFNSPPLQDK PPKAFSSLAG ALRAPLFALL PRGRRRRMHD 100
    LRRRWDLGSL CRALLTRGLA AVGHSLKHVL SAIFSKIFGP LASVGNMDEK 150
    SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES 200
    SARFVPRYNF SRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI 250
    QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV 300
    PAVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV 350
    CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV 400
    GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM 450
    NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ 500
    FMRQKEHQDA RRKRQEQRKF LKGRFLQTHF QSQSQGQSQS QSPGQNLSQN 550
    PNPNPNQNLT QNLSHNLTPS SNPNSTQREN RGSQKQGSGQ GQGDSGTSNG 600
    TNDYIGSVET WR 612
    Length:612
    Mass (Da):69,198
    Last modified:January 9, 2007 - v3
    Checksum:i12551E4408936D8D
    GO
    Isoform 2 (identifier: Q80UW0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-146: Missing.

    Show »
    Length:466
    Mass (Da):53,737
    Checksum:i12304F0E8EDF93CE
    GO
    Isoform 3 (identifier: Q80UW0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         316-316: R → RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGK

    Note: No experimental confirmation available.

    Show »
    Length:652
    Mass (Da):73,553
    Checksum:i4E3F3D370B4E3FC3
    GO

    Sequence cautioni

    The sequence BAC34950.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti419 – 4191E → D in BAE42608. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 146146Missing in isoform 2. 2 PublicationsVSP_015848Add
    BLAST
    Alternative sequencei316 – 3161R → RWRIFQILDGTSKDRWGSSN FNSGANSPSSTKPRSTSKSG K in isoform 3. 2 PublicationsVSP_015849

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK052348 mRNA. Translation: BAC34950.1. Different initiation.
    AK171680 mRNA. Translation: BAE42608.1.
    AL671918, AL672057 Genomic DNA. Translation: CAM16284.1.
    AL672057, AL671918 Genomic DNA. Translation: CAM21295.1.
    AL672099 Genomic DNA. No translation available.
    BC047151 mRNA. Translation: AAH47151.1.
    BC063327 mRNA. Translation: AAH63327.1.
    AB024565 mRNA. Translation: BAA89247.1.
    CCDSiCCDS40970.1. [Q80UW0-3]
    CCDS72379.1. [Q80UW0-1]
    RefSeqiNP_001070670.1. NM_001077202.2. [Q80UW0-3]
    NP_001277396.1. NM_001290467.1. [Q80UW0-1]
    NP_001277397.1. NM_001290468.1.
    NP_056634.3. NM_015819.4. [Q80UW0-2]
    XP_006541581.1. XM_006541518.1.
    XP_006541582.1. XM_006541519.1.
    UniGeneiMm.252561.

    Genome annotation databases

    EnsembliENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. [Q80UW0-3]
    ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. [Q80UW0-1]
    GeneIDi50786.
    KEGGimmu:50786.
    UCSCiuc009tdw.1. mouse. [Q80UW0-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK052348 mRNA. Translation: BAC34950.1 . Different initiation.
    AK171680 mRNA. Translation: BAE42608.1 .
    AL671918 , AL672057 Genomic DNA. Translation: CAM16284.1 .
    AL672057 , AL671918 Genomic DNA. Translation: CAM21295.1 .
    AL672099 Genomic DNA. No translation available.
    BC047151 mRNA. Translation: AAH47151.1 .
    BC063327 mRNA. Translation: AAH63327.1 .
    AB024565 mRNA. Translation: BAA89247.1 .
    CCDSi CCDS40970.1. [Q80UW0-3 ]
    CCDS72379.1. [Q80UW0-1 ]
    RefSeqi NP_001070670.1. NM_001077202.2. [Q80UW0-3 ]
    NP_001277396.1. NM_001290467.1. [Q80UW0-1 ]
    NP_001277397.1. NM_001290468.1.
    NP_056634.3. NM_015819.4. [Q80UW0-2 ]
    XP_006541581.1. XM_006541518.1.
    XP_006541582.1. XM_006541519.1.
    UniGenei Mm.252561.

    3D structure databases

    ProteinModelPortali Q80UW0.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q80UW0.

    Proteomic databases

    PaxDbi Q80UW0.
    PRIDEi Q80UW0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000088172 ; ENSMUSP00000085497 ; ENSMUSG00000062184 . [Q80UW0-3 ]
    ENSMUST00000114871 ; ENSMUSP00000110521 ; ENSMUSG00000062184 . [Q80UW0-1 ]
    GeneIDi 50786.
    KEGGi mmu:50786.
    UCSCi uc009tdw.1. mouse. [Q80UW0-1 ]

    Organism-specific databases

    CTDi 90161.
    MGIi MGI:1354959. Hs6st2.

    Phylogenomic databases

    eggNOGi NOG302961.
    GeneTreei ENSGT00390000013468.
    HOGENOMi HOG000007772.
    HOVERGENi HBG083012.
    KOi K08102.
    OMAi LRPSRWR.
    OrthoDBi EOG75MVW3.
    TreeFami TF312835.

    Enzyme and pathway databases

    Reactomei REACT_198654. HS-GAG biosynthesis.

    Miscellaneous databases

    NextBioi 307753.
    PROi Q80UW0.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q80UW0.
    CleanExi MM_HS6ST2.
    Genevestigatori Q80UW0.

    Family and domain databases

    InterProi IPR010635. Heparan_SO4-6-sulfoTrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view ]
    PANTHERi PTHR12812. PTHR12812. 1 hit.
    Pfami PF03567. Sulfotransfer_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-409 (ISOFORM 3).
      Strain: C57BL/6J.
      Tissue: Heart.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 78-612 (ISOFORM 1).
      Strain: FVB/N-3.
      Tissue: Brain and Mammary tumor.
    4. "The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase having different specificities for hexuronic acid adjacent to the targeted N-sulfoglucosamine."
      Habuchi H., Tanaka M., Habuchi O., Yoshida K., Suzuki H., Ban K., Kimata K.
      J. Biol. Chem. 275:2859-2868(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-612 (ISOFORM 3).
      Tissue: Brain.

    Entry informationi

    Entry nameiH6ST2_MOUSE
    AccessioniPrimary (citable) accession number: Q80UW0
    Secondary accession number(s): A2AEM4
    , Q3TAR0, Q6P4N9, Q8C785, Q9QYK6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 11, 2005
    Last sequence update: January 9, 2007
    Last modified: October 1, 2014
    This is version 91 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3