Q80UW0 (H6ST2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heparan-sulfate 6-O-sulfotransferase 2 Short name=HS6ST-2 Short name=mHS6ST-2 EC=2.8.2.- | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 612 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. |
| Catalytic activity | 3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate. |
| Subcellular location | Membrane; Single-pass type II membrane protein Potential. |
| Sequence similarities | Belongs to the sulfotransferase 6 family. |
| Sequence caution | The sequence BAC34950.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Transferase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | sulfotransferase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q80UW0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q80UW0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-146: Missing. | ||||||
| Isoform 3 (identifier: Q80UW0-3) The sequence of this isoform differs from the canonical sequence as follows: 316-316: R → RWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 612 | 612 | Heparan-sulfate 6-O-sulfotransferase 2 | PRO_0000190806 | |||||
Regions | |||||||||
| Topological domain | 1 – 4 | 4 | Cytoplasmic Potential | ||||||
| Transmembrane | 5 – 27 | 23 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 28 – 612 | 585 | Lumenal Potential | ||||||
| Region | 236 – 242 | 7 | 5'-phosphosulfate-binding Potential | ||||||
| Region | 325 – 333 | 9 | 3'-phosphate binding Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 404 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 460 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 546 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 558 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 562 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 574 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 599 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 146 | 146 | Missing in isoform 2. | VSP_015848 | |||||
| Alternative sequence | 316 | 1 | R → RWRIFQILDGTSKDRWGSSN FNSGANSPSSTKPRSTSKSG K in isoform 3. | VSP_015849 | |||||
Experimental info | |||||||||
| Sequence conflict | 419 | 1 | E → D in BAE42608. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-409 (ISOFORM 3). Strain: C57BL/6J. Tissue: Heart. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 78-612 (ISOFORM 1). Strain: FVB/N-3. Tissue: Brain and Mammary tumor. |
| [4] | "The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase having different specificities for hexuronic acid adjacent to the targeted N-sulfoglucosamine." Habuchi H., Tanaka M., Habuchi O., Yoshida K., Suzuki H., Ban K., Kimata K. J. Biol. Chem. 275:2859-2868(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-612 (ISOFORM 3). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK052348 mRNA. Translation: BAC34950.1. Different initiation. AK171680 mRNA. Translation: BAE42608.1. AL671918, AL672057 Genomic DNA. Translation: CAM16284.1. AL672057, AL671918 Genomic DNA. Translation: CAM21295.1. AL672099 Genomic DNA. No translation available. BC047151 mRNA. Translation: AAH47151.1. BC063327 mRNA. Translation: AAH63327.1. AB024565 mRNA. Translation: BAA89247.1. |
| IPI | IPI00136281. IPI00330386. IPI00471111. |
| RefSeq | NP_001070670.1. NM_001077202.1. NP_056634.3. NM_015819.3. |
| UniGene | Mm.252561. |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q80UW0. |
Proteomic databases | |
| PaxDb | Q80UW0. |
| PRIDE | Q80UW0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000088172; ENSMUSP00000085497; ENSMUSG00000062184. ENSMUST00000114871; ENSMUSP00000110521; ENSMUSG00000062184. |
| GeneID | 50786. |
| KEGG | mmu:50786. |
| UCSC | uc009tdw.1. mouse. uc009tdz.1. mouse. |
Organism-specific databases | |
| CTD | 90161. |
| MGI | MGI:1354959. Hs6st2. |
Phylogenomic databases | |
| eggNOG | NOG302961. |
| GeneTree | ENSGT00390000013468. |
| HOGENOM | HOG000007772. |
| HOVERGEN | HBG083012. |
| KO | K08102. |
| OrthoDB | EOG4X6C8G. |
Gene expression databases | |
| ArrayExpress | Q80UW0. |
| Bgee | Q80UW0. |
| CleanEx | MM_HS6ST2. |
| Genevestigator | Q80UW0. |
| GermOnline | ENSMUSG00000062184. Mus musculus. |
Family and domain databases | |
| InterPro | IPR010635. Heparan_SO4-6-sulfoTrfase. IPR005331. Sulfotransferase. [Graphical view] |
| PANTHER | PTHR12812. PTHR12812. 1 hit. |
| Pfam | PF03567. Sulfotransfer_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 307753. |
| SOURCE | Search... |
Entry information
| Entry name | H6ST2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q80UW0 Secondary accession number(s): A2AEM4 Q9QYK6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
