Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase Praja-2

Gene

Pja2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has E2-dependent E3 ubiquitin-protein ligase activity. Responsible for ubiquitination of cAMP-dependent protein kinase type I and type II-alpha/beta regulatory subunits and for targeting them for proteasomal degradation. Essential for PKA-mediated long-term memory processes (By similarity).By similarity1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri633 – 67442RING-type; atypicalPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase Praja-2 (EC:6.3.2.-)
Short name:
Praja2
Alternative name(s):
RING finger protein 131
Gene namesi
Name:Pja2
Synonyms:Kiaa0438, Rnf131
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:2159342. Pja2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 707706E3 ubiquitin-protein ligase Praja-2PRO_0000278231Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei306 – 3061PhosphoserineBy similarity
Modified residuei320 – 3201PhosphoserineBy similarity
Modified residuei339 – 3391Phosphoserine; by PKABy similarity
Modified residuei385 – 3851Phosphothreonine; by PKABy similarity
Modified residuei430 – 4301PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ80U04.
PaxDbiQ80U04.
PeptideAtlasiQ80U04.
PRIDEiQ80U04.

PTM databases

iPTMnetiQ80U04.
PhosphoSiteiQ80U04.

Expressioni

Gene expression databases

BgeeiENSMUSG00000024083.
CleanExiMM_PJA2.
GenevisibleiQ80U04. MM.

Interactioni

Subunit structurei

Binds ubiquitin-conjugating enzymes (E2s). In vitro, interacts with the ubiquitin-conjugating enzyme, UBE2D2. The phosphorylated form interacts with PRKAR1A, PRKAR2A and PRKAR2B. Binds the catalytic subunits of cAMP-dependent protein kinase (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi230345. 1 interaction.
DIPiDIP-47060N.
IntActiQ80U04. 2 interactions.
MINTiMINT-4385303.
STRINGi10090.ENSMUSP00000024888.

Structurei

3D structure databases

ProteinModelPortaliQ80U04.
SMRiQ80U04. Positions 602-679.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni530 – 707178Interaction with PRKAR1A, PRKAR2A and PRKAR2BBy similarityAdd
BLAST

Sequence similaritiesi

Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri633 – 67442RING-type; atypicalPROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0800. Eukaryota.
ENOG41121N2. LUCA.
GeneTreeiENSGT00530000062967.
HOGENOMiHOG000230900.
HOVERGENiHBG003815.
InParanoidiQ80U04.
KOiK10634.
OMAiAQPEAFM.
OrthoDBiEOG091G0306.
PhylomeDBiQ80U04.
TreeFamiTF330711.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR030639. Praja-2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR15710:SF5. PTHR15710:SF5. 1 hit.
PfamiPF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80U04-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQYTEKEPS VMDQESSKAA WPKPAGGYQT ITGRRYGRRH AYVSFKPCMT
60 70 80 90 100
RHERSLGRAG DDYEVLELDD VPKENTSGSS SLDQVHPALP NEPTVEKSET
110 120 130 140 150
EISTCGPALN QSTESSPSIA TVCHSEEVRE TLESNTNLHN RTETEHTPAV
160 170 180 190 200
CNVSSVQNGI MLVHTDSYDP DSKHDENGSL QLGAEAVEGG RHQKGLGRAV
210 220 230 240 250
FELENGEAEI YADLSPSVPS LNGEISEAFE ELDSAPLEKS STADAELVHQ
260 270 280 290 300
NGQEFQRSSE DGVVRKRRQD DTDQGRQTEN STEDADCAPG HVEQNTSDRA
310 320 330 340 350
NHHGSSPEQV VRPKVRKVIS SSQVDQEIGF NRHEAKQRSV QRWREALEVE
360 370 380 390 400
ECSSDDPIIK CDDYDGDHDC MFLTPTYSRV TQRETERNRV TSENGATASG
410 420 430 440 450
RQESRDNAFW NACGEYYQLF DKDEDSSECS DGEWSASLPH RFSGTEKDQS
460 470 480 490 500
SSDDSWETLP GKDENDPELQ SDSSGPEEEN QELSLQEGEQ TSLEEGEIPW
510 520 530 540 550
LQYNEVNESS SDEGNEPANE FAQPEAFMLD GNNNLEDDSS VSEDLDVDWS
560 570 580 590 600
LFDGFADGLG VAEAISYVDP QFLTYMALEE RLAQAMETAL AHLESLAVDV
610 620 630 640 650
EVANPPASKE SIDGLPETLV LEDHTAIGQE QCCPICCSEY IKDDIATELP
660 670 680 690 700
CHHFFHKPCV SIWLQKSGTC PVCRRHFPPA VIDASAAASS DPDPDASPAN

DNAEEAP
Length:707
Mass (Da):77,958
Last modified:February 20, 2007 - v2
Checksum:iF0D45E2267CC7EAA
GO
Isoform 2 (identifier: Q80U04-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     426-488: SSECSDGEWSASLPHRFSGTEKDQSSSDDSWETLPGKDENDPELQSDSSGPEEENQELSLQEG → R

Show »
Length:645
Mass (Da):71,243
Checksum:iAE65AB4FE9FD6FF8
GO

Sequence cautioni

The sequence BAC65564 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti230 – 2301E → A in BAE40303 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei426 – 48863SSECS…SLQEG → R in isoform 2. 2 PublicationsVSP_023199Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF493070 mRNA. Translation: AAO85470.1.
AK122282 mRNA. Translation: BAC65564.1. Different initiation.
AK144586 mRNA. Translation: BAE25949.1.
AK168371 mRNA. Translation: BAE40303.1.
BC004742 mRNA. Translation: AAH04742.1.
BC017130 mRNA. Translation: AAH17130.1.
CCDSiCCDS37674.1. [Q80U04-2]
CCDS37675.1. [Q80U04-1]
RefSeqiNP_001020480.1. NM_001025309.1. [Q80U04-1]
NP_659108.1. NM_144859.2. [Q80U04-2]
UniGeneiMm.489681.

Genome annotation databases

EnsembliENSMUST00000024888; ENSMUSP00000024888; ENSMUSG00000024083. [Q80U04-1]
ENSMUST00000024889; ENSMUSP00000024889; ENSMUSG00000024083. [Q80U04-2]
ENSMUST00000172733; ENSMUSP00000133730; ENSMUSG00000024083. [Q80U04-2]
ENSMUST00000172818; ENSMUSP00000134380; ENSMUSG00000024083. [Q80U04-1]
GeneIDi224938.
KEGGimmu:224938.
UCSCiuc008dfu.1. mouse. [Q80U04-1]
uc008dfv.1. mouse. [Q80U04-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF493070 mRNA. Translation: AAO85470.1.
AK122282 mRNA. Translation: BAC65564.1. Different initiation.
AK144586 mRNA. Translation: BAE25949.1.
AK168371 mRNA. Translation: BAE40303.1.
BC004742 mRNA. Translation: AAH04742.1.
BC017130 mRNA. Translation: AAH17130.1.
CCDSiCCDS37674.1. [Q80U04-2]
CCDS37675.1. [Q80U04-1]
RefSeqiNP_001020480.1. NM_001025309.1. [Q80U04-1]
NP_659108.1. NM_144859.2. [Q80U04-2]
UniGeneiMm.489681.

3D structure databases

ProteinModelPortaliQ80U04.
SMRiQ80U04. Positions 602-679.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi230345. 1 interaction.
DIPiDIP-47060N.
IntActiQ80U04. 2 interactions.
MINTiMINT-4385303.
STRINGi10090.ENSMUSP00000024888.

PTM databases

iPTMnetiQ80U04.
PhosphoSiteiQ80U04.

Proteomic databases

MaxQBiQ80U04.
PaxDbiQ80U04.
PeptideAtlasiQ80U04.
PRIDEiQ80U04.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024888; ENSMUSP00000024888; ENSMUSG00000024083. [Q80U04-1]
ENSMUST00000024889; ENSMUSP00000024889; ENSMUSG00000024083. [Q80U04-2]
ENSMUST00000172733; ENSMUSP00000133730; ENSMUSG00000024083. [Q80U04-2]
ENSMUST00000172818; ENSMUSP00000134380; ENSMUSG00000024083. [Q80U04-1]
GeneIDi224938.
KEGGimmu:224938.
UCSCiuc008dfu.1. mouse. [Q80U04-1]
uc008dfv.1. mouse. [Q80U04-2]

Organism-specific databases

CTDi9867.
MGIiMGI:2159342. Pja2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0800. Eukaryota.
ENOG41121N2. LUCA.
GeneTreeiENSGT00530000062967.
HOGENOMiHOG000230900.
HOVERGENiHBG003815.
InParanoidiQ80U04.
KOiK10634.
OMAiAQPEAFM.
OrthoDBiEOG091G0306.
PhylomeDBiQ80U04.
TreeFamiTF330711.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiPja2. mouse.
PROiQ80U04.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024083.
CleanExiMM_PJA2.
GenevisibleiQ80U04. MM.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR030639. Praja-2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR15710:SF5. PTHR15710:SF5. 1 hit.
PfamiPF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPJA2_MOUSE
AccessioniPrimary (citable) accession number: Q80U04
Secondary accession number(s): Q3TH95
, Q810E3, Q91W46, Q99KC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: February 20, 2007
Last modified: September 7, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.