Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q80TS5 (ZN423_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 88. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 423
Alternative name(s):
Early B-cell factor-associated zinc finger protein
Olf1/EBF-associated zinc finger protein
Smad- and Olf-interacting zinc finger protein
Gene names
Name:Znf423
Synonyms:Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1292 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation. Ref.6 Ref.7 Ref.8 Ref.9

Subunit structure

Homodimer By similarity. Interacts with SMAD1 and SMAD4. Interacts with EBF1 By similarity. Interacts with PARP1. Interacts with CEP290 By similarity. Ref.5

Subcellular location

Nucleus By similarity.

Tissue specificity

Within the cerebellum, Zfp423 is expressed in both ventricular and external germinal zones. Transiently expressed in newly differentiating olfactory-receptor neurons. Ref.6 Ref.7 Ref.9

Developmental stage

During embryogenesis, it is highly expressed at the dorsal neuroepithelium flanking the roof plate. Ref.8

Domain

Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs By similarity.

Disruption phenotype

Mice are runted and ataxic, the cerebellum is underdeveloped, and the vermis is severely reduced, resulting in diminished proliferation by granule cell precursors in the external germinal layer, especially near the midline, and abnormal differentiation and migration of ventricular zone-derived neurons and Bergmann glia. In the remaining cerebellar structures, the Purkinje cells are poorly developed and mislocalized. Ref.6 Ref.7

Miscellaneous

Znf423 gene is a frequent target of retroviral integration in murine B-cell lymphomas.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 30 C2H2-type zinc fingers.

Sequence caution

The sequence AAG17053.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH59234.1 differs from that shown. Reason: Chimeric cDNA.

The sequence BAC65647.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q80TS5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q80TS5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAA → MTGAERGPLCYH

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12921292Zinc finger protein 423
PRO_0000308596

Regions

Zinc finger75 – 10127C2H2-type 1; degenerate
Zinc finger146 – 16823C2H2-type 2
Zinc finger174 – 19623C2H2-type 3
Zinc finger202 – 22423C2H2-type 4
Zinc finger230 – 25223C2H2-type 5
Zinc finger271 – 29424C2H2-type 6
Zinc finger303 – 32624C2H2-type 7
Zinc finger331 – 35323C2H2-type 8
Zinc finger417 – 44125C2H2-type 9; degenerate
Zinc finger449 – 47224C2H2-type 10
Zinc finger488 – 51124C2H2-type 11
Zinc finger525 – 54824C2H2-type 12
Zinc finger571 – 59626C2H2-type 13; atypical
Zinc finger640 – 66223C2H2-type 14
Zinc finger670 – 69223C2H2-type 15
Zinc finger700 – 72324C2H2-type 16
Zinc finger728 – 75124C2H2-type 17
Zinc finger758 – 78124C2H2-type 18
Zinc finger789 – 81123C2H2-type 19
Zinc finger815 – 83824C2H2-type 20
Zinc finger894 – 91623C2H2-type 21; degenerate
Zinc finger938 – 96023C2H2-type 22
Zinc finger967 – 98923C2H2-type 23
Zinc finger1028 – 105023C2H2-type 24
Zinc finger1072 – 109019C2H2-type 25; degenerate
Zinc finger1128 – 115124C2H2-type 26
Zinc finger1176 – 119823C2H2-type 27
Zinc finger1206 – 122823C2H2-type 28
Zinc finger1237 – 126024C2H2-type 29
Zinc finger1267 – 129024C2H2-type 30

Amino acid modifications

Modified residue551Phosphoserine By similarity
Modified residue581Phosphoserine By similarity
Modified residue6121Phosphoserine By similarity
Modified residue10621Phosphoserine By similarity

Natural variations

Alternative sequence1 – 3333MSRRK…SVAAA → MTGAERGPLCYH in isoform 2.
VSP_029008

Experimental info

Sequence conflict7351E → K in AAG17053. Ref.4
Sequence conflict11821Q → R in AAP33073. Ref.1
Sequence conflict11821Q → R in AAN39840. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 23, 2007. Version 2.
Checksum: 6E0EE26DDCF65E63

FASTA1,292145,351
        10         20         30         40         50         60 
MSRRKQAKPR SVKVEEGEAS DFSLAWDSSV AAAGGLEGEP ECDRKTSRAL EDRNSVTSQE 

        70         80         90        100        110        120 
ERNEDDEDVE DESIYTCDHC QQDFESLADL TDHRAHRCPG DGDDDPQLSW VASSPSSKDV 

       130        140        150        160        170        180 
ASPTQMIGDG CDLGLGEEEG GTGLPYPCQF CDKSFIRLSY LKRHEQIHSD KLPFKCTFCS 

       190        200        210        220        230        240 
RLFKHKRSRD RHIKLHTGDK KYHCHECEAA FSRSDHLKIH LKTHSSSKPF KCSVCKRGFS 

       250        260        270        280        290        300 
STSSLQSHMQ AHKKNKEHLA KSEKEAKKDD FMCDYCEDTF SQTEELEKHV LTLHPQLSEK 

       310        320        330        340        350        360 
ADLQCIHCPE VFVDESTLLA HIHQAHANQK HKCPMCPEQF SSVEGVYCHL DSHRQPDSSN 

       370        380        390        400        410        420 
HSVSPDPVLG SVASMSSATP DSSASVERGS TPDSTLKPLR GQKKMRDDGQ SWPKVVYSCP 

       430        440        450        460        470        480 
YCSKRDFTSL AVLEIHLKTI HADKPQQSHT CQICLDSMPT LYNLNEHVRK LHKSHAYPVM 

       490        500        510        520        530        540 
QFGNISAFHC NYCPEMFADI NSLQEHIRVS HCGPNANPPD GNNAFFCNQC SMGFLTESSL 

       550        560        570        580        590        600 
TEHIQQAHCS VGSTKLESPV VQPTQSFMEV YSCPYCTNSP IFGSILKLTK HIKENHKNIP 

       610        620        630        640        650        660 
LAHSKKSKAE QSPVSSDVEV SSPKRQRLSG SANSISNGEY PCNQCDLKFS NFESFQTHLK 

       670        680        690        700        710        720 
LHLELLLRKQ ACPQCKEDFD SQESLLQHLT VHYMTTSTHY VCESCDKQFS SVDDLQKHLL 

       730        740        750        760        770        780 
DMHTFVLYHC TLCQEVFDSK VSIQVHLAVK HSNEKKMYRC TACNWDFRKE ADLQVHVKHS 

       790        800        810        820        830        840 
HLGNPAKAHK CIFCGETFST EVELQCHITT HSKKYNCRFC SKAFHAVILL EKHLREKHCV 

       850        860        870        880        890        900 
FDAAAENGTA NGVPPTSTKK AEPADLQGML LKNPEAPNSH EASEDDVDAS EPMYGCDICG 

       910        920        930        940        950        960 
AAYTMEVLLQ NHRLRDHNIR PGEDDGSRKK AEFIKGSHKC NVCSRTFFSE NGLREHLQTH 

       970        980        990       1000       1010       1020 
RGPAKHYMCP ICGERFPSLL TLTEHKVTHS KSLDTGTCRI CKMPLQSEEE FIEHCQMHPD 

      1030       1040       1050       1060       1070       1080 
LRNSLTGFRC VVCMQTVTST LELKIHGTFH MQKLAGSSAA SSPNGQGLQK LYKCALCLKE 

      1090       1100       1110       1120       1130       1140 
FRSKQDLVRL DVNGLPYGLC AGCMARSANG QVGGLAPPEP ADRPCAGLRC PECNVKFESA 

      1150       1160       1170       1180       1190       1200 
EDLESHMQVD HRDLTPETSG PRKGAQTSPV PRKKTYQCIK CQMTFENERE IQIHVANHMI 

      1210       1220       1230       1240       1250       1260 
EEGINHECKL CNQMFDSPAK LLCHLIEHSF EGMGGTFKCP VCFTVFVQAN KLQQHIFAVH 

      1270       1280       1290 
GQEDKIYDCS QCPQKFFFQT ELQNHTMSQH AQ 

« Hide

Isoform 2 [UniParc].

Checksum: 773ADBC9915C9E0C
Show »

FASTA1,271143,090

References

« Hide 'large scale' references
[1]"Early B-cell factor-associated zinc-finger gene is a frequent target of retroviral integration in murine B-cell lymphomas."
Warming S., Suzuki T., Yamaguchi T.P., Jenkins N.A., Copeland N.G.
Oncogene 23:2727-2731(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Strain: BALB/c.
Tissue: Brain.
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6.
Tissue: Brain.
[4]"cDNA sequence and map assignment of Ebfaz, orthologous to the zinc finger transcription factor gene Roaz."
Croci L., Corradi A., Vauti F., Wurst W., Rocchi M., Consalez G.G.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-1292.
[5]"Poly(ADP-ribose) polymerase 1 interacts with OAZ and regulates BMP-target genes."
Ku M.-C., Stewart S., Hata A.
Biochem. Biophys. Res. Commun. 311:702-707(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PARP1.
[6]"Zfp423 is required for normal cerebellar development."
Warming S., Rachel R.A., Jenkins N.A., Copeland N.G.
Mol. Cell. Biol. 26:6913-6922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
[7]"Zfp423 controls proliferation and differentiation of neural precursors in cerebellar vermis formation."
Alcaraz W.A., Gold D.A., Raponi E., Gent P.M., Concepcion D., Hamilton B.A.
Proc. Natl. Acad. Sci. U.S.A. 103:19424-19429(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
[8]"The transcription factor Zfp423/OAZ is required for cerebellar development and CNS midline patterning."
Cheng L.E., Zhang J., Reed R.R.
Dev. Biol. 307:43-52(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, DEVELOPMENTAL STAGE.
[9]"Zfp423/OAZ participates in a developmental switch during olfactory neurogenesis."
Cheng L.E., Reed R.R.
Neuron 54:547-557(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY147407 mRNA. Translation: AAN39840.1.
AY256893 mRNA. Translation: AAP33073.1.
AK122365 mRNA. Translation: BAC65647.1. Different initiation.
BC059234 mRNA. Translation: AAH59234.1. Sequence problems.
BC139028 mRNA. Translation: AAI39029.1.
BC139030 mRNA. Translation: AAI39031.1.
AF188609 mRNA. Translation: AAG17053.1. Different initiation.
CCDSCCDS52627.1. [Q80TS5-1]
RefSeqNP_201584.2. NM_033327.2. [Q80TS5-1]
UniGeneMm.23452.
Mm.472447.

3D structure databases

ProteinModelPortalQ80TS5.
SMRQ80TS5. Positions 40-360, 649-835, 936-989, 1168-1292.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ80TS5. 2 interactions.

PTM databases

PhosphoSiteQ80TS5.

Proteomic databases

PaxDbQ80TS5.
PRIDEQ80TS5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333. [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333. [Q80TS5-1]
GeneID94187.
KEGGmmu:94187.
UCSCuc009mqv.1. mouse. [Q80TS5-1]

Organism-specific databases

CTD94187.
MGIMGI:1891217. Zfp423.
RougeSearch...

Phylogenomic databases

eggNOGCOG5048.
GeneTreeENSGT00750000117220.
HOGENOMHOG000155793.
HOVERGENHBG052773.
InParanoidB2RSW4.
OMAFIEHCQM.
PhylomeDBQ80TS5.
TreeFamTF331504.

Gene expression databases

ArrayExpressQ80TS5.
BgeeQ80TS5.
CleanExMM_ZFP423.
GenevestigatorQ80TS5.

Family and domain databases

Gene3D3.30.160.60. 4 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00096. zf-C2H2. 4 hits.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 30 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 27 hits.
PS50157. ZINC_FINGER_C2H2_2. 23 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio352155.
PROQ80TS5.
SOURCESearch...

Entry information

Entry nameZN423_MOUSE
AccessionPrimary (citable) accession number: Q80TS5
Secondary accession number(s): B2RSW4 expand/collapse secondary AC list , Q6PCP2, Q6X497, Q8CIQ1, Q9ESD2
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot