SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q80TS5

- ZN423_MOUSE

UniProt

Q80TS5 - ZN423_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein 423
Gene
Znf423, Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.4 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri75 – 10127C2H2-type 1; degenerate
Add
BLAST
Zinc fingeri146 – 16823C2H2-type 2
Add
BLAST
Zinc fingeri174 – 19623C2H2-type 3
Add
BLAST
Zinc fingeri202 – 22423C2H2-type 4
Add
BLAST
Zinc fingeri230 – 25223C2H2-type 5
Add
BLAST
Zinc fingeri271 – 29424C2H2-type 6
Add
BLAST
Zinc fingeri303 – 32624C2H2-type 7
Add
BLAST
Zinc fingeri331 – 35323C2H2-type 8
Add
BLAST
Zinc fingeri417 – 44125C2H2-type 9; degenerate
Add
BLAST
Zinc fingeri449 – 47224C2H2-type 10
Add
BLAST
Zinc fingeri488 – 51124C2H2-type 11
Add
BLAST
Zinc fingeri525 – 54824C2H2-type 12
Add
BLAST
Zinc fingeri571 – 59626C2H2-type 13; atypical
Add
BLAST
Zinc fingeri640 – 66223C2H2-type 14
Add
BLAST
Zinc fingeri670 – 69223C2H2-type 15
Add
BLAST
Zinc fingeri700 – 72324C2H2-type 16
Add
BLAST
Zinc fingeri728 – 75124C2H2-type 17
Add
BLAST
Zinc fingeri758 – 78124C2H2-type 18
Add
BLAST
Zinc fingeri789 – 81123C2H2-type 19
Add
BLAST
Zinc fingeri815 – 83824C2H2-type 20
Add
BLAST
Zinc fingeri894 – 91623C2H2-type 21; degenerate
Add
BLAST
Zinc fingeri938 – 96023C2H2-type 22
Add
BLAST
Zinc fingeri967 – 98923C2H2-type 23
Add
BLAST
Zinc fingeri1028 – 105023C2H2-type 24
Add
BLAST
Zinc fingeri1072 – 109019C2H2-type 25; degenerate
Add
BLAST
Zinc fingeri1128 – 115124C2H2-type 26
Add
BLAST
Zinc fingeri1176 – 119823C2H2-type 27
Add
BLAST
Zinc fingeri1206 – 122823C2H2-type 28
Add
BLAST
Zinc fingeri1237 – 126024C2H2-type 29
Add
BLAST
Zinc fingeri1267 – 129024C2H2-type 30
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. Notch signaling pathway Source: UniProtKB
  2. cell differentiation Source: UniProtKB-KW
  3. negative regulation of transcription, DNA-templated Source: Ensembl
  4. nervous system development Source: UniProtKB-KW
  5. positive regulation of BMP signaling pathway Source: UniProtKB
  6. positive regulation of transcription, DNA-templated Source: UniProtKB
  7. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein, Repressor

Keywords - Biological processi

Differentiation, Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 423
Alternative name(s):
Early B-cell factor-associated zinc finger protein
Olf1/EBF-associated zinc finger protein
Smad- and Olf-interacting zinc finger protein
Gene namesi
Name:Znf423
Synonyms:Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 8

Organism-specific databases

MGIiMGI:1891217. Zfp423.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice are runted and ataxic, the cerebellum is underdeveloped, and the vermis is severely reduced, resulting in diminished proliferation by granule cell precursors in the external germinal layer, especially near the midline, and abnormal differentiation and migration of ventricular zone-derived neurons and Bergmann glia. In the remaining cerebellar structures, the Purkinje cells are poorly developed and mislocalized.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12921292Zinc finger protein 423
PRO_0000308596Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei55 – 551Phosphoserine By similarity
Modified residuei58 – 581Phosphoserine By similarity
Modified residuei612 – 6121Phosphoserine By similarity
Modified residuei1062 – 10621Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ80TS5.
PRIDEiQ80TS5.

PTM databases

PhosphoSiteiQ80TS5.

Expressioni

Tissue specificityi

Within the cerebellum, Zfp423 is expressed in both ventricular and external germinal zones. Transiently expressed in newly differentiating olfactory-receptor neurons.3 Publications

Developmental stagei

During embryogenesis, it is highly expressed at the dorsal neuroepithelium flanking the roof plate.1 Publication

Gene expression databases

ArrayExpressiQ80TS5.
BgeeiQ80TS5.
CleanExiMM_ZFP423.
GenevestigatoriQ80TS5.

Interactioni

Subunit structurei

Homodimer By similarity. Interacts with SMAD1 and SMAD4. Interacts with EBF1 By similarity. Interacts with PARP1. Interacts with CEP290 By similarity.1 Publication

Protein-protein interaction databases

IntActiQ80TS5. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ80TS5.
SMRiQ80TS5. Positions 40-360, 649-835, 936-989, 1168-1292.

Family & Domainsi

Domaini

Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs By similarity.

Sequence similaritiesi

Contains 30 C2H2-type zinc fingers.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00750000117220.
HOGENOMiHOG000155793.
HOVERGENiHBG052773.
InParanoidiB2RSW4.
OMAiFIEHCQM.
PhylomeDBiQ80TS5.
TreeFamiTF331504.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 4 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 30 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 27 hits.
PS50157. ZINC_FINGER_C2H2_2. 23 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q80TS5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSRRKQAKPR SVKVEEGEAS DFSLAWDSSV AAAGGLEGEP ECDRKTSRAL     50
EDRNSVTSQE ERNEDDEDVE DESIYTCDHC QQDFESLADL TDHRAHRCPG 100
DGDDDPQLSW VASSPSSKDV ASPTQMIGDG CDLGLGEEEG GTGLPYPCQF 150
CDKSFIRLSY LKRHEQIHSD KLPFKCTFCS RLFKHKRSRD RHIKLHTGDK 200
KYHCHECEAA FSRSDHLKIH LKTHSSSKPF KCSVCKRGFS STSSLQSHMQ 250
AHKKNKEHLA KSEKEAKKDD FMCDYCEDTF SQTEELEKHV LTLHPQLSEK 300
ADLQCIHCPE VFVDESTLLA HIHQAHANQK HKCPMCPEQF SSVEGVYCHL 350
DSHRQPDSSN HSVSPDPVLG SVASMSSATP DSSASVERGS TPDSTLKPLR 400
GQKKMRDDGQ SWPKVVYSCP YCSKRDFTSL AVLEIHLKTI HADKPQQSHT 450
CQICLDSMPT LYNLNEHVRK LHKSHAYPVM QFGNISAFHC NYCPEMFADI 500
NSLQEHIRVS HCGPNANPPD GNNAFFCNQC SMGFLTESSL TEHIQQAHCS 550
VGSTKLESPV VQPTQSFMEV YSCPYCTNSP IFGSILKLTK HIKENHKNIP 600
LAHSKKSKAE QSPVSSDVEV SSPKRQRLSG SANSISNGEY PCNQCDLKFS 650
NFESFQTHLK LHLELLLRKQ ACPQCKEDFD SQESLLQHLT VHYMTTSTHY 700
VCESCDKQFS SVDDLQKHLL DMHTFVLYHC TLCQEVFDSK VSIQVHLAVK 750
HSNEKKMYRC TACNWDFRKE ADLQVHVKHS HLGNPAKAHK CIFCGETFST 800
EVELQCHITT HSKKYNCRFC SKAFHAVILL EKHLREKHCV FDAAAENGTA 850
NGVPPTSTKK AEPADLQGML LKNPEAPNSH EASEDDVDAS EPMYGCDICG 900
AAYTMEVLLQ NHRLRDHNIR PGEDDGSRKK AEFIKGSHKC NVCSRTFFSE 950
NGLREHLQTH RGPAKHYMCP ICGERFPSLL TLTEHKVTHS KSLDTGTCRI 1000
CKMPLQSEEE FIEHCQMHPD LRNSLTGFRC VVCMQTVTST LELKIHGTFH 1050
MQKLAGSSAA SSPNGQGLQK LYKCALCLKE FRSKQDLVRL DVNGLPYGLC 1100
AGCMARSANG QVGGLAPPEP ADRPCAGLRC PECNVKFESA EDLESHMQVD 1150
HRDLTPETSG PRKGAQTSPV PRKKTYQCIK CQMTFENERE IQIHVANHMI 1200
EEGINHECKL CNQMFDSPAK LLCHLIEHSF EGMGGTFKCP VCFTVFVQAN 1250
KLQQHIFAVH GQEDKIYDCS QCPQKFFFQT ELQNHTMSQH AQ 1292
Length:1,292
Mass (Da):145,351
Last modified:October 23, 2007 - v2
Checksum:i6E0EE26DDCF65E63
GO
Isoform 2 (identifier: Q80TS5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAA → MTGAERGPLCYH

Show »
Length:1,271
Mass (Da):143,090
Checksum:i773ADBC9915C9E0C
GO

Sequence cautioni

The sequence AAH59234.1 differs from that shown. Reason: Chimeric cDNA.
The sequence AAG17053.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAC65647.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MSRRK…SVAAA → MTGAERGPLCYH in isoform 2.
VSP_029008Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti735 – 7351E → K in AAG17053. 1 Publication
Sequence conflicti1182 – 11821Q → R in AAP33073. 1 Publication
Sequence conflicti1182 – 11821Q → R in AAN39840. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY147407 mRNA. Translation: AAN39840.1.
AY256893 mRNA. Translation: AAP33073.1.
AK122365 mRNA. Translation: BAC65647.1. Different initiation.
BC059234 mRNA. Translation: AAH59234.1. Sequence problems.
BC139028 mRNA. Translation: AAI39029.1.
BC139030 mRNA. Translation: AAI39031.1.
AF188609 mRNA. Translation: AAG17053.1. Different initiation.
CCDSiCCDS52627.1. [Q80TS5-1]
RefSeqiNP_201584.2. NM_033327.2. [Q80TS5-1]
UniGeneiMm.23452.
Mm.472447.

Genome annotation databases

EnsembliENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333. [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333. [Q80TS5-1]
GeneIDi94187.
KEGGimmu:94187.
UCSCiuc009mqv.1. mouse. [Q80TS5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY147407 mRNA. Translation: AAN39840.1 .
AY256893 mRNA. Translation: AAP33073.1 .
AK122365 mRNA. Translation: BAC65647.1 . Different initiation.
BC059234 mRNA. Translation: AAH59234.1 . Sequence problems.
BC139028 mRNA. Translation: AAI39029.1 .
BC139030 mRNA. Translation: AAI39031.1 .
AF188609 mRNA. Translation: AAG17053.1 . Different initiation.
CCDSi CCDS52627.1. [Q80TS5-1 ]
RefSeqi NP_201584.2. NM_033327.2. [Q80TS5-1 ]
UniGenei Mm.23452.
Mm.472447.

3D structure databases

ProteinModelPortali Q80TS5.
SMRi Q80TS5. Positions 40-360, 649-835, 936-989, 1168-1292.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q80TS5. 2 interactions.

PTM databases

PhosphoSitei Q80TS5.

Proteomic databases

PaxDbi Q80TS5.
PRIDEi Q80TS5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000052250 ; ENSMUSP00000052379 ; ENSMUSG00000045333 . [Q80TS5-2 ]
ENSMUST00000109655 ; ENSMUSP00000105282 ; ENSMUSG00000045333 . [Q80TS5-1 ]
GeneIDi 94187.
KEGGi mmu:94187.
UCSCi uc009mqv.1. mouse. [Q80TS5-1 ]

Organism-specific databases

CTDi 94187.
MGIi MGI:1891217. Zfp423.
Rougei Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00750000117220.
HOGENOMi HOG000155793.
HOVERGENi HBG052773.
InParanoidi B2RSW4.
OMAi FIEHCQM.
PhylomeDBi Q80TS5.
TreeFami TF331504.

Miscellaneous databases

NextBioi 352155.
PROi Q80TS5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q80TS5.
Bgeei Q80TS5.
CleanExi MM_ZFP423.
Genevestigatori Q80TS5.

Family and domain databases

Gene3Di 3.30.160.60. 4 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 4 hits.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 30 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 27 hits.
PS50157. ZINC_FINGER_C2H2_2. 23 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Early B-cell factor-associated zinc-finger gene is a frequent target of retroviral integration in murine B-cell lymphomas."
    Warming S., Suzuki T., Yamaguchi T.P., Jenkins N.A., Copeland N.G.
    Oncogene 23:2727-2731(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: BALB/c.
    Tissue: Brain.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain.
  4. "cDNA sequence and map assignment of Ebfaz, orthologous to the zinc finger transcription factor gene Roaz."
    Croci L., Corradi A., Vauti F., Wurst W., Rocchi M., Consalez G.G.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-1292.
  5. "Poly(ADP-ribose) polymerase 1 interacts with OAZ and regulates BMP-target genes."
    Ku M.-C., Stewart S., Hata A.
    Biochem. Biophys. Res. Commun. 311:702-707(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PARP1.
  6. "Zfp423 is required for normal cerebellar development."
    Warming S., Rachel R.A., Jenkins N.A., Copeland N.G.
    Mol. Cell. Biol. 26:6913-6922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
  7. "Zfp423 controls proliferation and differentiation of neural precursors in cerebellar vermis formation."
    Alcaraz W.A., Gold D.A., Raponi E., Gent P.M., Concepcion D., Hamilton B.A.
    Proc. Natl. Acad. Sci. U.S.A. 103:19424-19429(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
  8. "The transcription factor Zfp423/OAZ is required for cerebellar development and CNS midline patterning."
    Cheng L.E., Zhang J., Reed R.R.
    Dev. Biol. 307:43-52(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DEVELOPMENTAL STAGE.
  9. "Zfp423/OAZ participates in a developmental switch during olfactory neurogenesis."
    Cheng L.E., Reed R.R.
    Neuron 54:547-557(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiZN423_MOUSE
AccessioniPrimary (citable) accession number: Q80TS5
Secondary accession number(s): B2RSW4
, Q6PCP2, Q6X497, Q8CIQ1, Q9ESD2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Znf423 gene is a frequent target of retroviral integration in murine B-cell lymphomas.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi