Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 423

Gene

Znf423

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 101C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST27
Zinc fingeri146 – 168C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri174 – 196C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri202 – 224C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri230 – 252C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri271 – 294C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri303 – 326C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri331 – 353C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 441C2H2-type 9; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri449 – 472C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri488 – 511C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri525 – 548C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri571 – 596C2H2-type 13; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri670 – 692C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri700 – 723C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri728 – 751C2H2-type 17PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri758 – 781C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri789 – 811C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri815 – 838C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri894 – 916C2H2-type 21; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri938 – 960C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri967 – 989C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1028 – 1050C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1072 – 1090C2H2-type 25; degeneratePROSITE-ProRule annotationAdd BLAST19
Zinc fingeri1128 – 1151C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1176 – 1198C2H2-type 27PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1206 – 1228C2H2-type 28PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1237 – 1260C2H2-type 29PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1267 – 1290C2H2-type 30PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

  • cell differentiation Source: UniProtKB-KW
  • negative regulation of transcription, DNA-templated Source: MGI
  • nervous system development Source: UniProtKB-KW
  • Notch signaling pathway Source: UniProtKB
  • positive regulation of BMP signaling pathway Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein, Repressor

Keywords - Biological processi

Differentiation, Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 423
Alternative name(s):
Early B-cell factor-associated zinc finger protein
Olf1/EBF-associated zinc finger protein
Smad- and Olf-interacting zinc finger protein
Gene namesi
Name:Znf423
Synonyms:Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1891217. Zfp423.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice are runted and ataxic, the cerebellum is underdeveloped, and the vermis is severely reduced, resulting in diminished proliferation by granule cell precursors in the external germinal layer, especially near the midline, and abnormal differentiation and migration of ventricular zone-derived neurons and Bergmann glia. In the remaining cerebellar structures, the Purkinje cells are poorly developed and mislocalized.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003085961 – 1292Zinc finger protein 423Add BLAST1292

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei55PhosphoserineBy similarity1
Modified residuei58PhosphoserineBy similarity1
Modified residuei612PhosphoserineBy similarity1
Modified residuei1062PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ80TS5.
PRIDEiQ80TS5.

PTM databases

iPTMnetiQ80TS5.
PhosphoSitePlusiQ80TS5.

Expressioni

Tissue specificityi

Within the cerebellum, Zfp423 is expressed in both ventricular and external germinal zones. Transiently expressed in newly differentiating olfactory-receptor neurons.3 Publications

Developmental stagei

During embryogenesis, it is highly expressed at the dorsal neuroepithelium flanking the roof plate.1 Publication

Gene expression databases

BgeeiENSMUSG00000045333.
CleanExiMM_ZFP423.
ExpressionAtlasiQ80TS5. baseline and differential.
GenevisibleiQ80TS5. MM.

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with SMAD1 and SMAD4. Interacts with EBF1 (By similarity). Interacts with PARP1. Interacts with CEP290 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ80TS5. 2 interactors.
STRINGi10090.ENSMUSP00000105282.

Structurei

3D structure databases

ProteinModelPortaliQ80TS5.
SMRiQ80TS5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs (By similarity).By similarity

Sequence similaritiesi

Contains 30 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 101C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST27
Zinc fingeri146 – 168C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri174 – 196C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri202 – 224C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri230 – 252C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri271 – 294C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri303 – 326C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri331 – 353C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 441C2H2-type 9; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri449 – 472C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri488 – 511C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri525 – 548C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri571 – 596C2H2-type 13; atypicalPROSITE-ProRule annotationAdd BLAST26
Zinc fingeri640 – 662C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri670 – 692C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri700 – 723C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri728 – 751C2H2-type 17PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri758 – 781C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri789 – 811C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri815 – 838C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri894 – 916C2H2-type 21; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri938 – 960C2H2-type 22PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri967 – 989C2H2-type 23PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1028 – 1050C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1072 – 1090C2H2-type 25; degeneratePROSITE-ProRule annotationAdd BLAST19
Zinc fingeri1128 – 1151C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1176 – 1198C2H2-type 27PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1206 – 1228C2H2-type 28PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1237 – 1260C2H2-type 29PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1267 – 1290C2H2-type 30PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129874.
HOGENOMiHOG000155793.
HOVERGENiHBG052773.
InParanoidiQ80TS5.
OMAiFIEHCQM.
OrthoDBiEOG091G00X5.
PhylomeDBiQ80TS5.
TreeFamiTF331504.

Family and domain databases

Gene3Di3.30.160.60. 5 hits.
3.30.40.10. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 30 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 27 hits.
PS50157. ZINC_FINGER_C2H2_2. 23 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80TS5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRRKQAKPR SVKVEEGEAS DFSLAWDSSV AAAGGLEGEP ECDRKTSRAL
60 70 80 90 100
EDRNSVTSQE ERNEDDEDVE DESIYTCDHC QQDFESLADL TDHRAHRCPG
110 120 130 140 150
DGDDDPQLSW VASSPSSKDV ASPTQMIGDG CDLGLGEEEG GTGLPYPCQF
160 170 180 190 200
CDKSFIRLSY LKRHEQIHSD KLPFKCTFCS RLFKHKRSRD RHIKLHTGDK
210 220 230 240 250
KYHCHECEAA FSRSDHLKIH LKTHSSSKPF KCSVCKRGFS STSSLQSHMQ
260 270 280 290 300
AHKKNKEHLA KSEKEAKKDD FMCDYCEDTF SQTEELEKHV LTLHPQLSEK
310 320 330 340 350
ADLQCIHCPE VFVDESTLLA HIHQAHANQK HKCPMCPEQF SSVEGVYCHL
360 370 380 390 400
DSHRQPDSSN HSVSPDPVLG SVASMSSATP DSSASVERGS TPDSTLKPLR
410 420 430 440 450
GQKKMRDDGQ SWPKVVYSCP YCSKRDFTSL AVLEIHLKTI HADKPQQSHT
460 470 480 490 500
CQICLDSMPT LYNLNEHVRK LHKSHAYPVM QFGNISAFHC NYCPEMFADI
510 520 530 540 550
NSLQEHIRVS HCGPNANPPD GNNAFFCNQC SMGFLTESSL TEHIQQAHCS
560 570 580 590 600
VGSTKLESPV VQPTQSFMEV YSCPYCTNSP IFGSILKLTK HIKENHKNIP
610 620 630 640 650
LAHSKKSKAE QSPVSSDVEV SSPKRQRLSG SANSISNGEY PCNQCDLKFS
660 670 680 690 700
NFESFQTHLK LHLELLLRKQ ACPQCKEDFD SQESLLQHLT VHYMTTSTHY
710 720 730 740 750
VCESCDKQFS SVDDLQKHLL DMHTFVLYHC TLCQEVFDSK VSIQVHLAVK
760 770 780 790 800
HSNEKKMYRC TACNWDFRKE ADLQVHVKHS HLGNPAKAHK CIFCGETFST
810 820 830 840 850
EVELQCHITT HSKKYNCRFC SKAFHAVILL EKHLREKHCV FDAAAENGTA
860 870 880 890 900
NGVPPTSTKK AEPADLQGML LKNPEAPNSH EASEDDVDAS EPMYGCDICG
910 920 930 940 950
AAYTMEVLLQ NHRLRDHNIR PGEDDGSRKK AEFIKGSHKC NVCSRTFFSE
960 970 980 990 1000
NGLREHLQTH RGPAKHYMCP ICGERFPSLL TLTEHKVTHS KSLDTGTCRI
1010 1020 1030 1040 1050
CKMPLQSEEE FIEHCQMHPD LRNSLTGFRC VVCMQTVTST LELKIHGTFH
1060 1070 1080 1090 1100
MQKLAGSSAA SSPNGQGLQK LYKCALCLKE FRSKQDLVRL DVNGLPYGLC
1110 1120 1130 1140 1150
AGCMARSANG QVGGLAPPEP ADRPCAGLRC PECNVKFESA EDLESHMQVD
1160 1170 1180 1190 1200
HRDLTPETSG PRKGAQTSPV PRKKTYQCIK CQMTFENERE IQIHVANHMI
1210 1220 1230 1240 1250
EEGINHECKL CNQMFDSPAK LLCHLIEHSF EGMGGTFKCP VCFTVFVQAN
1260 1270 1280 1290
KLQQHIFAVH GQEDKIYDCS QCPQKFFFQT ELQNHTMSQH AQ
Length:1,292
Mass (Da):145,351
Last modified:October 23, 2007 - v2
Checksum:i6E0EE26DDCF65E63
GO
Isoform 2 (identifier: Q80TS5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAA → MTGAERGPLCYH

Show »
Length:1,271
Mass (Da):143,090
Checksum:i773ADBC9915C9E0C
GO

Sequence cautioni

The sequence AAG17053 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH59234 differs from that shown. Chimeric cDNA.Curated
The sequence BAC65647 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti735E → K in AAG17053 (Ref. 4) Curated1
Sequence conflicti1182Q → R in AAP33073 (PubMed:15048087).Curated1
Sequence conflicti1182Q → R in AAN39840 (PubMed:15048087).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0290081 – 33MSRRK…SVAAA → MTGAERGPLCYH in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY147407 mRNA. Translation: AAN39840.1.
AY256893 mRNA. Translation: AAP33073.1.
AK122365 mRNA. Translation: BAC65647.1. Different initiation.
BC059234 mRNA. Translation: AAH59234.1. Sequence problems.
BC139028 mRNA. Translation: AAI39029.1.
BC139030 mRNA. Translation: AAI39031.1.
AF188609 mRNA. Translation: AAG17053.1. Different initiation.
CCDSiCCDS52627.1. [Q80TS5-1]
RefSeqiNP_201584.2. NM_033327.2. [Q80TS5-1]
UniGeneiMm.23452.
Mm.472447.

Genome annotation databases

EnsembliENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333. [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333. [Q80TS5-1]
GeneIDi94187.
KEGGimmu:94187.
UCSCiuc009mqv.1. mouse. [Q80TS5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY147407 mRNA. Translation: AAN39840.1.
AY256893 mRNA. Translation: AAP33073.1.
AK122365 mRNA. Translation: BAC65647.1. Different initiation.
BC059234 mRNA. Translation: AAH59234.1. Sequence problems.
BC139028 mRNA. Translation: AAI39029.1.
BC139030 mRNA. Translation: AAI39031.1.
AF188609 mRNA. Translation: AAG17053.1. Different initiation.
CCDSiCCDS52627.1. [Q80TS5-1]
RefSeqiNP_201584.2. NM_033327.2. [Q80TS5-1]
UniGeneiMm.23452.
Mm.472447.

3D structure databases

ProteinModelPortaliQ80TS5.
SMRiQ80TS5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ80TS5. 2 interactors.
STRINGi10090.ENSMUSP00000105282.

PTM databases

iPTMnetiQ80TS5.
PhosphoSitePlusiQ80TS5.

Proteomic databases

PaxDbiQ80TS5.
PRIDEiQ80TS5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333. [Q80TS5-2]
ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333. [Q80TS5-1]
GeneIDi94187.
KEGGimmu:94187.
UCSCiuc009mqv.1. mouse. [Q80TS5-1]

Organism-specific databases

CTDi94187.
MGIiMGI:1891217. Zfp423.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129874.
HOGENOMiHOG000155793.
HOVERGENiHBG052773.
InParanoidiQ80TS5.
OMAiFIEHCQM.
OrthoDBiEOG091G00X5.
PhylomeDBiQ80TS5.
TreeFamiTF331504.

Miscellaneous databases

PROiQ80TS5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000045333.
CleanExiMM_ZFP423.
ExpressionAtlasiQ80TS5. baseline and differential.
GenevisibleiQ80TS5. MM.

Family and domain databases

Gene3Di3.30.160.60. 5 hits.
3.30.40.10. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13912. zf-C2H2_6. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 30 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 27 hits.
PS50157. ZINC_FINGER_C2H2_2. 23 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN423_MOUSE
AccessioniPrimary (citable) accession number: Q80TS5
Secondary accession number(s): B2RSW4
, Q6PCP2, Q6X497, Q8CIQ1, Q9ESD2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: November 30, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Znf423 gene is a frequent target of retroviral integration in murine B-cell lymphomas.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.