Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q80TS5

- ZN423_MOUSE

UniProt

Q80TS5 - ZN423_MOUSE

Protein

Zinc finger protein 423

Gene

Znf423

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 2 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.4 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri75 – 10127C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri146 – 16823C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri174 – 19623C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri202 – 22423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri230 – 25223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri271 – 29424C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri303 – 32624C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri331 – 35323C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri417 – 44125C2H2-type 9; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri449 – 47224C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri488 – 51124C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri525 – 54824C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri571 – 59626C2H2-type 13; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri640 – 66223C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri670 – 69223C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri700 – 72324C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri728 – 75124C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri758 – 78124C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri789 – 81123C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri815 – 83824C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri894 – 91623C2H2-type 21; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri938 – 96023C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri967 – 98923C2H2-type 23PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1028 – 105023C2H2-type 24PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1072 – 109019C2H2-type 25; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1128 – 115124C2H2-type 26PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1176 – 119823C2H2-type 27PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1206 – 122823C2H2-type 28PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1237 – 126024C2H2-type 29PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1267 – 129024C2H2-type 30PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. negative regulation of transcription, DNA-templated Source: Ensembl
    3. nervous system development Source: UniProtKB-KW
    4. Notch signaling pathway Source: UniProtKB
    5. positive regulation of BMP signaling pathway Source: UniProtKB
    6. positive regulation of transcription, DNA-templated Source: UniProtKB
    7. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Developmental protein, Repressor

    Keywords - Biological processi

    Differentiation, Neurogenesis, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 423
    Alternative name(s):
    Early B-cell factor-associated zinc finger protein
    Olf1/EBF-associated zinc finger protein
    Smad- and Olf-interacting zinc finger protein
    Gene namesi
    Name:Znf423
    Synonyms:Ebfaz, Kiaa0760, Nur12, Oaz, Zfp423
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 8

    Organism-specific databases

    MGIiMGI:1891217. Zfp423.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Mice are runted and ataxic, the cerebellum is underdeveloped, and the vermis is severely reduced, resulting in diminished proliferation by granule cell precursors in the external germinal layer, especially near the midline, and abnormal differentiation and migration of ventricular zone-derived neurons and Bergmann glia. In the remaining cerebellar structures, the Purkinje cells are poorly developed and mislocalized.2 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12921292Zinc finger protein 423PRO_0000308596Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei55 – 551PhosphoserineBy similarity
    Modified residuei58 – 581PhosphoserineBy similarity
    Modified residuei612 – 6121PhosphoserineBy similarity
    Modified residuei1062 – 10621PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ80TS5.
    PRIDEiQ80TS5.

    PTM databases

    PhosphoSiteiQ80TS5.

    Expressioni

    Tissue specificityi

    Within the cerebellum, Zfp423 is expressed in both ventricular and external germinal zones. Transiently expressed in newly differentiating olfactory-receptor neurons.3 Publications

    Developmental stagei

    During embryogenesis, it is highly expressed at the dorsal neuroepithelium flanking the roof plate.1 Publication

    Gene expression databases

    ArrayExpressiQ80TS5.
    BgeeiQ80TS5.
    CleanExiMM_ZFP423.
    GenevestigatoriQ80TS5.

    Interactioni

    Subunit structurei

    Homodimer By similarity. Interacts with SMAD1 and SMAD4. Interacts with EBF1 By similarity. Interacts with PARP1. Interacts with CEP290 By similarity.By similarity

    Protein-protein interaction databases

    IntActiQ80TS5. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ80TS5.
    SMRiQ80TS5. Positions 40-360, 649-835, 936-989, 1168-1292.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domaini

    Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs By similarity.By similarity

    Sequence similaritiesi

    Contains 30 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri75 – 10127C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri146 – 16823C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri174 – 19623C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri202 – 22423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri230 – 25223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri271 – 29424C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri303 – 32624C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri331 – 35323C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri417 – 44125C2H2-type 9; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri449 – 47224C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri488 – 51124C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri525 – 54824C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri571 – 59626C2H2-type 13; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri640 – 66223C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri670 – 69223C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri700 – 72324C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri728 – 75124C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri758 – 78124C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri789 – 81123C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri815 – 83824C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri894 – 91623C2H2-type 21; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri938 – 96023C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri967 – 98923C2H2-type 23PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1028 – 105023C2H2-type 24PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1072 – 109019C2H2-type 25; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1128 – 115124C2H2-type 26PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1176 – 119823C2H2-type 27PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1206 – 122823C2H2-type 28PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1237 – 126024C2H2-type 29PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1267 – 129024C2H2-type 30PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    GeneTreeiENSGT00750000117220.
    HOGENOMiHOG000155793.
    HOVERGENiHBG052773.
    InParanoidiB2RSW4.
    OMAiFIEHCQM.
    PhylomeDBiQ80TS5.
    TreeFamiTF331504.

    Family and domain databases

    Gene3Di3.30.160.60. 4 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 4 hits.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 30 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 27 hits.
    PS50157. ZINC_FINGER_C2H2_2. 23 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q80TS5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRRKQAKPR SVKVEEGEAS DFSLAWDSSV AAAGGLEGEP ECDRKTSRAL     50
    EDRNSVTSQE ERNEDDEDVE DESIYTCDHC QQDFESLADL TDHRAHRCPG 100
    DGDDDPQLSW VASSPSSKDV ASPTQMIGDG CDLGLGEEEG GTGLPYPCQF 150
    CDKSFIRLSY LKRHEQIHSD KLPFKCTFCS RLFKHKRSRD RHIKLHTGDK 200
    KYHCHECEAA FSRSDHLKIH LKTHSSSKPF KCSVCKRGFS STSSLQSHMQ 250
    AHKKNKEHLA KSEKEAKKDD FMCDYCEDTF SQTEELEKHV LTLHPQLSEK 300
    ADLQCIHCPE VFVDESTLLA HIHQAHANQK HKCPMCPEQF SSVEGVYCHL 350
    DSHRQPDSSN HSVSPDPVLG SVASMSSATP DSSASVERGS TPDSTLKPLR 400
    GQKKMRDDGQ SWPKVVYSCP YCSKRDFTSL AVLEIHLKTI HADKPQQSHT 450
    CQICLDSMPT LYNLNEHVRK LHKSHAYPVM QFGNISAFHC NYCPEMFADI 500
    NSLQEHIRVS HCGPNANPPD GNNAFFCNQC SMGFLTESSL TEHIQQAHCS 550
    VGSTKLESPV VQPTQSFMEV YSCPYCTNSP IFGSILKLTK HIKENHKNIP 600
    LAHSKKSKAE QSPVSSDVEV SSPKRQRLSG SANSISNGEY PCNQCDLKFS 650
    NFESFQTHLK LHLELLLRKQ ACPQCKEDFD SQESLLQHLT VHYMTTSTHY 700
    VCESCDKQFS SVDDLQKHLL DMHTFVLYHC TLCQEVFDSK VSIQVHLAVK 750
    HSNEKKMYRC TACNWDFRKE ADLQVHVKHS HLGNPAKAHK CIFCGETFST 800
    EVELQCHITT HSKKYNCRFC SKAFHAVILL EKHLREKHCV FDAAAENGTA 850
    NGVPPTSTKK AEPADLQGML LKNPEAPNSH EASEDDVDAS EPMYGCDICG 900
    AAYTMEVLLQ NHRLRDHNIR PGEDDGSRKK AEFIKGSHKC NVCSRTFFSE 950
    NGLREHLQTH RGPAKHYMCP ICGERFPSLL TLTEHKVTHS KSLDTGTCRI 1000
    CKMPLQSEEE FIEHCQMHPD LRNSLTGFRC VVCMQTVTST LELKIHGTFH 1050
    MQKLAGSSAA SSPNGQGLQK LYKCALCLKE FRSKQDLVRL DVNGLPYGLC 1100
    AGCMARSANG QVGGLAPPEP ADRPCAGLRC PECNVKFESA EDLESHMQVD 1150
    HRDLTPETSG PRKGAQTSPV PRKKTYQCIK CQMTFENERE IQIHVANHMI 1200
    EEGINHECKL CNQMFDSPAK LLCHLIEHSF EGMGGTFKCP VCFTVFVQAN 1250
    KLQQHIFAVH GQEDKIYDCS QCPQKFFFQT ELQNHTMSQH AQ 1292
    Length:1,292
    Mass (Da):145,351
    Last modified:October 23, 2007 - v2
    Checksum:i6E0EE26DDCF65E63
    GO
    Isoform 2 (identifier: Q80TS5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAA → MTGAERGPLCYH

    Show »
    Length:1,271
    Mass (Da):143,090
    Checksum:i773ADBC9915C9E0C
    GO

    Sequence cautioni

    The sequence AAH59234.1 differs from that shown. Reason: Chimeric cDNA.
    The sequence AAG17053.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC65647.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti735 – 7351E → K in AAG17053. 1 PublicationCurated
    Sequence conflicti1182 – 11821Q → R in AAP33073. (PubMed:15048087)Curated
    Sequence conflicti1182 – 11821Q → R in AAN39840. (PubMed:15048087)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3333MSRRK…SVAAA → MTGAERGPLCYH in isoform 2. 1 PublicationVSP_029008Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY147407 mRNA. Translation: AAN39840.1.
    AY256893 mRNA. Translation: AAP33073.1.
    AK122365 mRNA. Translation: BAC65647.1. Different initiation.
    BC059234 mRNA. Translation: AAH59234.1. Sequence problems.
    BC139028 mRNA. Translation: AAI39029.1.
    BC139030 mRNA. Translation: AAI39031.1.
    AF188609 mRNA. Translation: AAG17053.1. Different initiation.
    CCDSiCCDS52627.1. [Q80TS5-1]
    RefSeqiNP_201584.2. NM_033327.2. [Q80TS5-1]
    UniGeneiMm.23452.
    Mm.472447.

    Genome annotation databases

    EnsembliENSMUST00000052250; ENSMUSP00000052379; ENSMUSG00000045333. [Q80TS5-2]
    ENSMUST00000109655; ENSMUSP00000105282; ENSMUSG00000045333. [Q80TS5-1]
    GeneIDi94187.
    KEGGimmu:94187.
    UCSCiuc009mqv.1. mouse. [Q80TS5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY147407 mRNA. Translation: AAN39840.1 .
    AY256893 mRNA. Translation: AAP33073.1 .
    AK122365 mRNA. Translation: BAC65647.1 . Different initiation.
    BC059234 mRNA. Translation: AAH59234.1 . Sequence problems.
    BC139028 mRNA. Translation: AAI39029.1 .
    BC139030 mRNA. Translation: AAI39031.1 .
    AF188609 mRNA. Translation: AAG17053.1 . Different initiation.
    CCDSi CCDS52627.1. [Q80TS5-1 ]
    RefSeqi NP_201584.2. NM_033327.2. [Q80TS5-1 ]
    UniGenei Mm.23452.
    Mm.472447.

    3D structure databases

    ProteinModelPortali Q80TS5.
    SMRi Q80TS5. Positions 40-360, 649-835, 936-989, 1168-1292.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q80TS5. 2 interactions.

    PTM databases

    PhosphoSitei Q80TS5.

    Proteomic databases

    PaxDbi Q80TS5.
    PRIDEi Q80TS5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000052250 ; ENSMUSP00000052379 ; ENSMUSG00000045333 . [Q80TS5-2 ]
    ENSMUST00000109655 ; ENSMUSP00000105282 ; ENSMUSG00000045333 . [Q80TS5-1 ]
    GeneIDi 94187.
    KEGGi mmu:94187.
    UCSCi uc009mqv.1. mouse. [Q80TS5-1 ]

    Organism-specific databases

    CTDi 94187.
    MGIi MGI:1891217. Zfp423.
    Rougei Search...

    Phylogenomic databases

    eggNOGi COG5048.
    GeneTreei ENSGT00750000117220.
    HOGENOMi HOG000155793.
    HOVERGENi HBG052773.
    InParanoidi B2RSW4.
    OMAi FIEHCQM.
    PhylomeDBi Q80TS5.
    TreeFami TF331504.

    Miscellaneous databases

    NextBioi 352155.
    PROi Q80TS5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q80TS5.
    Bgeei Q80TS5.
    CleanExi MM_ZFP423.
    Genevestigatori Q80TS5.

    Family and domain databases

    Gene3Di 3.30.160.60. 4 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 4 hits.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 30 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 27 hits.
    PS50157. ZINC_FINGER_C2H2_2. 23 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Early B-cell factor-associated zinc-finger gene is a frequent target of retroviral integration in murine B-cell lymphomas."
      Warming S., Suzuki T., Yamaguchi T.P., Jenkins N.A., Copeland N.G.
      Oncogene 23:2727-2731(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Strain: BALB/c.
      Tissue: Brain.
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6.
      Tissue: Brain.
    4. "cDNA sequence and map assignment of Ebfaz, orthologous to the zinc finger transcription factor gene Roaz."
      Croci L., Corradi A., Vauti F., Wurst W., Rocchi M., Consalez G.G.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 92-1292.
    5. "Poly(ADP-ribose) polymerase 1 interacts with OAZ and regulates BMP-target genes."
      Ku M.-C., Stewart S., Hata A.
      Biochem. Biophys. Res. Commun. 311:702-707(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PARP1.
    6. "Zfp423 is required for normal cerebellar development."
      Warming S., Rachel R.A., Jenkins N.A., Copeland N.G.
      Mol. Cell. Biol. 26:6913-6922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
    7. "Zfp423 controls proliferation and differentiation of neural precursors in cerebellar vermis formation."
      Alcaraz W.A., Gold D.A., Raponi E., Gent P.M., Concepcion D., Hamilton B.A.
      Proc. Natl. Acad. Sci. U.S.A. 103:19424-19429(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.
    8. "The transcription factor Zfp423/OAZ is required for cerebellar development and CNS midline patterning."
      Cheng L.E., Zhang J., Reed R.R.
      Dev. Biol. 307:43-52(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DEVELOPMENTAL STAGE.
    9. "Zfp423/OAZ participates in a developmental switch during olfactory neurogenesis."
      Cheng L.E., Reed R.R.
      Neuron 54:547-557(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiZN423_MOUSE
    AccessioniPrimary (citable) accession number: Q80TS5
    Secondary accession number(s): B2RSW4
    , Q6PCP2, Q6X497, Q8CIQ1, Q9ESD2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 89 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    Znf423 gene is a frequent target of retroviral integration in murine B-cell lymphomas.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3