Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nischarin

Gene

Nisch

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts either as the functional imidazoline-1 receptor (I1R) candidate or as a membrane-associated mediator of the I1R signaling. Binds numerous imidazoline ligands that induces initiation of cell-signaling cascades triggering to cell survival, growth and migration. Its activation by the agonist rilmenidine induces an increase in phosphorylation of mitogen-activated protein kinases MAPK1 and MAPK3 in rostral ventrolateral medulla (RVLM) neurons that exhibited rilmenidine-evoked hypotension (By similarity). Blocking its activation with efaroxan abolished rilmenidine-induced mitogen-activated protein kinase phosphorylation in RVLM neurons (By similarity). Acts as a modulator of Rac-regulated signal transduction pathways. Suppresses Rac1-stimulated cell migration by interacting with PAK1 and inhibiting its kinase activity. Also blocks Pak-independent Rac signaling by interacting with RAC1 and inhibiting Rac1-stimulated NF-kB response element and cyclin D1 promoter activation. Inhibits also LIMK1 kinase activity by reducing LIMK1 'Tyr-508' phosphorylation. Inhibits Rac-induced cell migration and invasion in breast and colon epithelial cells. Inhibits lamellipodia formation, when overexpressed. Plays a role in protection against apoptosis (By similarity). Involved in association with IRS4 in the enhancement of insulin activation of MAPK1 and MAPK3 (By similarity). When overexpressed, induces a redistribution of cell surface ITGA5 integrin to intracellular endosomal structures (By similarity).By similarity6 Publications

GO - Molecular functioni

  • integrin binding Source: MGI
  • phosphatidylinositol binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Nischarin
Alternative name(s):
Imidazoline receptor 1
Short name:
I-1
Short name:
IR1
Imidazoline receptor I-1-like protein
Imidazoline-1 receptor
Short name:
I1R
Gene namesi
Name:Nisch
Synonyms:Kiaa0975
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1928323. Nisch.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: MGI
  • early endosome Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB-SubCell
  • recycling endosome Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003482661 – 1593NischarinAdd BLAST1593

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei543PhosphoserineCombined sources1
Modified residuei545PhosphoserineCombined sources1
Modified residuei548PhosphoserineCombined sources1
Modified residuei1371PhosphothreonineCombined sources1
Modified residuei1373PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ80TM9.
PaxDbiQ80TM9.
PeptideAtlasiQ80TM9.
PRIDEiQ80TM9.

PTM databases

iPTMnetiQ80TM9.
PhosphoSitePlusiQ80TM9.

Expressioni

Tissue specificityi

Highly expressed in brain and kidney. Moderately expressed in heart, liver, lung and skeletal muscle. Not detected in spleen and testis.1 Publication

Developmental stagei

Expressed in embryo at 7 day dpc onwards.1 Publication

Gene expression databases

BgeeiENSMUSG00000021910.
ExpressionAtlasiQ80TM9. baseline and differential.
GenevisibleiQ80TM9. MM.

Interactioni

Subunit structurei

Homooligomer (By similarity). Interacts with GRB2 (By similarity). Interacts with PIK3R1; probably associates with the PI3-kinase complex (By similarity). Interacts with IRS4 (By similarity). Found in a complex with ITGA5 and PAK1. Found in a complex with LIMK1 and PAK1. Interacts with ITGA5 (via cytoplasmic domain); this interaction is direct. Interacts with PAK1 (via kinase domain); this interaction is direct and is increased upon activation of PAK1. Interacts with LIMK1 (via PDZ and kinase domain); this interaction is direct. Interacts with LIMK2; this interaction depends on LIMK2 activity. Interacts with RAC1 (activated state). Interacts with STK11; this interaction may increase STK11 activity (By similarity).By similarity

GO - Molecular functioni

  • integrin binding Source: MGI

Protein-protein interaction databases

BioGridi211089. 1 interactor.
IntActiQ80TM9. 1 interactor.
MINTiMINT-4128927.
STRINGi10090.ENSMUSP00000022469.

Structurei

3D structure databases

ProteinModelPortaliQ80TM9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 122PXPROSITE-ProRule annotationAdd BLAST111
Repeati290 – 311LRR 1Add BLAST22
Repeati313 – 334LRR 2Add BLAST22
Repeati335 – 356LRR 3Add BLAST22
Repeati358 – 379LRR 4Add BLAST22
Repeati380 – 401LRR 5Add BLAST22
Repeati405 – 426LRR 6Add BLAST22
Repeati1081 – 108616
Repeati1087 – 109226
Repeati1093 – 109836
Repeati1099 – 110446
Repeati1105 – 111056
Repeati1111 – 111666
Repeati1123 – 112876
Repeati1129 – 113486
Repeati1135 – 114096
Repeati1141 – 1146106

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 134Necessary for binding to phosphoinositide-3-P; not sufficient for targeting to endosomesBy similarityAdd BLAST134
Regioni121 – 695Necessary for homooligomerization and targeting to endosomesBy similarityAdd BLAST575
Regioni246 – 869Interaction with PAK11 PublicationAdd BLAST624
Regioni661 – 869Interaction with LIMKAdd BLAST209
Regioni709 – 807Interaction with ITGA5Add BLAST99
Regioni1081 – 114610 X 6 AA tandem repeat of A-E-A-P-A-AAdd BLAST66

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili624 – 694Sequence analysisAdd BLAST71

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi631 – 691Glu-richAdd BLAST61
Compositional biasi1041 – 1193Ala/Pro-richAdd BLAST153

Domaini

Both the presence of the PX domain and the coiled coil region are necessary for its endosomal targeting.By similarity

Sequence similaritiesi

Contains 6 LRR (leucine-rich) repeats.Curated
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG1259. Eukaryota.
ENOG410XQUS. LUCA.
GeneTreeiENSGT00530000063625.
HOVERGENiHBG108189.
InParanoidiQ80TM9.
OMAiYSGNIEW.
OrthoDBiEOG091G0707.
PhylomeDBiQ80TM9.
TreeFamiTF320547.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001683. Phox.
[Graphical view]
PfamiPF12799. LRR_4. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS51450. LRR. 6 hits.
PS50195. PX. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80TM9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAATLSFGP EREAEPAKEA RVVGSELVDT YTVYVIQVTD GNHEWTIKHR
60 70 80 90 100
YSDFHDLHEK LVAERKIDKS LLPPKKIIGK NSRSLVEKRE RDLEVYLQTL
110 120 130 140 150
LTTFPDVAPR VLAHFLHFHL YEVNGVTAAL AEELFEKGEQ LLGAGEVFAI
160 170 180 190 200
RPLQLYAITE QLQQGKPTCA SGDAKTDLGH ILDFTCRLKY LKVSGTEGPF
210 220 230 240 250
GTSNIKEQLL PFDLSIFKSL HQVEISHCDA KHIRGLVTSK PTLATMSVRF
260 270 280 290 300
SATSMKEVLA PEASEFDEWE PEGTATLGGP VTAIIPTWQA LTTLDLSHNS
310 320 330 340 350
ICEIDESVKL IPKIEYLDLS HNGLRVVDNL QHLYNLVHLD LSYNKLSSLE
360 370 380 390 400
GVHTKLGNVK TLNLAGNFLE SLSGLHKLYS LVNVDLRDNR IEQLDEVKSI
410 420 430 440 450
GSLPCLERLT LLNNPLSIIP DYRTKVLSQF GERASEICLD DVATTEKELD
460 470 480 490 500
TVEVLKAIQK AKDVKSKLSN TEKKAGEDFR LPPAPCIRPG GSPPAAPASA
510 520 530 540 550
SLPQPILSNQ GIMFVQEEAL ASSLSSTDSL PPEDHRPIAR ACSDSLESIP
560 570 580 590 600
AGQVASDDLR DVPGAVGGVS PDHAEPEVQV VPGSGQIIFL PFTCIGYTAT
610 620 630 640 650
NQDFIQRLST LIRQAIERQL PAWIEAANQR EEAHGEQGEE EEEEEEEEDV
660 670 680 690 700
AENRYFEMGP PDAEEEEGSG QGEEDEEDED EEAEEERLAL EWALGADEDF
710 720 730 740 750
LLEHIRILKV LWCFLIHVQG SIRQFAACLV LTDFGIAVFE IPHQESRGSS
760 770 780 790 800
QHILSSLRFV FCFPHGDLTE FGFLMPELCL VLKVRHSENT LFIISDAANL
810 820 830 840 850
HEFHADLRSC FAPQHMAMLC SPILYGSHTT LQEFLRQLLT FYKVAGGSQE
860 870 880 890 900
RSQGCFPVYL VYSDKRMVQT PAGDYSGNIE WASCTLCSAV RRSCCAPSEA
910 920 930 940 950
VKSAAIPYWL LLTSQHLNVI KADFNPMPNR GTHNCRNRNS FKLSRVPLST
960 970 980 990 1000
VLLDPTRSCT QPRGAFADGH VLELLVGYRF VTAIFVLPHE KFHFLRVYNQ
1010 1020 1030 1040 1050
LRASLQDLKT VVISKNPSAK PRNQPAKSRA SAEQRLQETP ADAPAPAAVP
1060 1070 1080 1090 1100
PTASAPAPAE ALAPDLAPVQ APGEDRGLTS AEAPAAAEAP AAAEAPAAAE
1110 1120 1130 1140 1150
APAAAEAPAA AEAPAAAEAP APAEAPAAAE APAAAEAPAA AEAPAAAEAP
1160 1170 1180 1190 1200
ASAEAPAPNQ APAPARGPAP ARGPAPAGGP APAEALAQAE VPAQYPSERL
1210 1220 1230 1240 1250
IQSTSEENQI PSHLPVCPSL QHIARLRGRA IIDLFHNSIA EVENEELRHL
1260 1270 1280 1290 1300
LWSSVVFYQT PGLEVTACVL LSSKAVYFIL HDGLRRYFSE PLQDFWHQKN
1310 1320 1330 1340 1350
TDYNNSPFHV SQCFVLKLSD LQSVNVGLFD QYFRLTGSSP TQVVTCLTRD
1360 1370 1380 1390 1400
SYLTHCFLQH LMLVLSSLER TPSPEPVDKD FYSEFGDKNT GKMENYELIH
1410 1420 1430 1440 1450
SSRVKFTYPS EEEVGDLTYI VAQKMADPAK NPALSILLYI QAFQVVTPHL
1460 1470 1480 1490 1500
GRGRGPLRPK TLLLTSAEIF LLDEDYIHYP LPEFAKEPPQ RDRYRLDDGR
1510 1520 1530 1540 1550
RVRDLDRVLM GYYPYPQALT LVFDDTQGHD LMGSVTLDHF GEMPGGPGRV
1560 1570 1580 1590
GQGREVQWQV FVPSAESREK LISLLARQWE ALCGRELPVE LTG
Length:1,593
Mass (Da):175,012
Last modified:September 2, 2008 - v2
Checksum:i90B407A165A4C1F8
GO
Isoform 2 (identifier: Q80TM9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-500: Missing.

Show »
Length:1,440
Mass (Da):158,425
Checksum:i8FFFBF697A5BEA01
GO
Isoform 3 (identifier: Q80TM9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-245: Missing.

Show »
Length:1,348
Mass (Da):147,611
Checksum:i9F92EED9E2342519
GO
Isoform 4 (identifier: Q80TM9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-472: ICLDDVATTEKELDTVEVLKAIQKAKDVKSKLSNTE → VSPRSSSRAQRDWQGKPSLSAKADRGKAVHSVLVFF
     473-1593: Missing.

Show »
Length:472
Mass (Da):52,609
Checksum:i115AB01516952992
GO
Isoform 5 (identifier: Q80TM9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     332-334: HLY → ATS
     335-1593: Missing.

Note: No experimental confirmation available.
Show »
Length:334
Mass (Da):37,131
Checksum:i00B86B5695E19BB7
GO
Isoform 6 (identifier: Q80TM9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     513-516: MFVQ → LGDE
     517-1593: Missing.

Show »
Length:516
Mass (Da):57,033
Checksum:i95AF24DEBE8B6BF9
GO
Isoform 7 (identifier: Q80TM9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-153: EVNGVTAALAEELFEKGEQLLGAGEVFAIRPL → VSSFGALCFAYEPTATKAVGLGFEETQTGPWP
     154-1593: Missing.

Show »
Length:153
Mass (Da):17,328
Checksum:i4E902C8FBC992DE7
GO

Sequence cautioni

The sequence AAH03270 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI08365 differs from that shown. Reason: Frameshift at position 1550.Curated
The sequence AAK52087 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC65694 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti607R → P in BAC65694 (PubMed:12693553).Curated1
Sequence conflicti1123 – 1128Missing in BAC65694 (PubMed:12693553).Curated6
Sequence conflicti1172R → RGPAPAG in AAG42100 (PubMed:11121431).Curated1
Sequence conflicti1518A → G in AAK52087 (Ref. 6) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0351361 – 245Missing in isoform 3. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_035137122 – 153EVNGV…AIRPL → VSSFGALCFAYEPTATKAVG LGFEETQTGPWP in isoform 7. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_035138154 – 1593Missing in isoform 7. 1 PublicationAdd BLAST1440
Alternative sequenceiVSP_035139332 – 334HLY → ATS in isoform 5. 1 Publication3
Alternative sequenceiVSP_035140335 – 1593Missing in isoform 5. 1 PublicationAdd BLAST1259
Alternative sequenceiVSP_035141348 – 500Missing in isoform 2. 1 PublicationAdd BLAST153
Alternative sequenceiVSP_035142437 – 472ICLDD…LSNTE → VSPRSSSRAQRDWQGKPSLS AKADRGKAVHSVLVFF in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035143473 – 1593Missing in isoform 4. 1 PublicationAdd BLAST1121
Alternative sequenceiVSP_035144513 – 516MFVQ → LGDE in isoform 6. 1 Publication4
Alternative sequenceiVSP_035145517 – 1593Missing in isoform 6. 1 PublicationAdd BLAST1077

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF315344 mRNA. Translation: AAG42100.1.
AK122412 mRNA. Translation: BAC65694.1. Different initiation.
AK036043 mRNA. Translation: BAC29286.1.
AK080441 mRNA. Translation: BAC37917.1.
AK086880 mRNA. Translation: BAC39757.1.
AC108416 Genomic DNA. No translation available.
AC154446 Genomic DNA. No translation available.
BC003270 mRNA. Translation: AAH03270.1. Different initiation.
BC108364 mRNA. Translation: AAI08365.1. Frameshift.
AY032852 mRNA. Translation: AAK52087.1. Different initiation.
AF144133 mRNA. Translation: AAD31521.1.
CCDSiCCDS36853.1. [Q80TM9-1]
RefSeqiNP_073147.2. NM_022656.2. [Q80TM9-1]
XP_006519417.2. XM_006519354.2. [Q80TM9-6]
UniGeneiMm.298728.

Genome annotation databases

EnsembliENSMUST00000022469; ENSMUSP00000022469; ENSMUSG00000021910. [Q80TM9-1]
ENSMUST00000164989; ENSMUSP00000126982; ENSMUSG00000021910. [Q80TM9-5]
ENSMUST00000165981; ENSMUSP00000130210; ENSMUSG00000021910. [Q80TM9-4]
ENSMUST00000168206; ENSMUSP00000132842; ENSMUSG00000021910. [Q80TM9-3]
ENSMUST00000171735; ENSMUSP00000127132; ENSMUSG00000021910. [Q80TM9-7]
ENSMUST00000172142; ENSMUSP00000132413; ENSMUSG00000021910. [Q80TM9-6]
GeneIDi64652.
KEGGimmu:64652.
UCSCiuc007swy.1. mouse. [Q80TM9-1]
uc007sxa.1. mouse. [Q80TM9-6]
uc007sxb.1. mouse. [Q80TM9-4]
uc007sxc.1. mouse. [Q80TM9-7]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF315344 mRNA. Translation: AAG42100.1.
AK122412 mRNA. Translation: BAC65694.1. Different initiation.
AK036043 mRNA. Translation: BAC29286.1.
AK080441 mRNA. Translation: BAC37917.1.
AK086880 mRNA. Translation: BAC39757.1.
AC108416 Genomic DNA. No translation available.
AC154446 Genomic DNA. No translation available.
BC003270 mRNA. Translation: AAH03270.1. Different initiation.
BC108364 mRNA. Translation: AAI08365.1. Frameshift.
AY032852 mRNA. Translation: AAK52087.1. Different initiation.
AF144133 mRNA. Translation: AAD31521.1.
CCDSiCCDS36853.1. [Q80TM9-1]
RefSeqiNP_073147.2. NM_022656.2. [Q80TM9-1]
XP_006519417.2. XM_006519354.2. [Q80TM9-6]
UniGeneiMm.298728.

3D structure databases

ProteinModelPortaliQ80TM9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi211089. 1 interactor.
IntActiQ80TM9. 1 interactor.
MINTiMINT-4128927.
STRINGi10090.ENSMUSP00000022469.

PTM databases

iPTMnetiQ80TM9.
PhosphoSitePlusiQ80TM9.

Proteomic databases

EPDiQ80TM9.
PaxDbiQ80TM9.
PeptideAtlasiQ80TM9.
PRIDEiQ80TM9.

Protocols and materials databases

DNASUi64652.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022469; ENSMUSP00000022469; ENSMUSG00000021910. [Q80TM9-1]
ENSMUST00000164989; ENSMUSP00000126982; ENSMUSG00000021910. [Q80TM9-5]
ENSMUST00000165981; ENSMUSP00000130210; ENSMUSG00000021910. [Q80TM9-4]
ENSMUST00000168206; ENSMUSP00000132842; ENSMUSG00000021910. [Q80TM9-3]
ENSMUST00000171735; ENSMUSP00000127132; ENSMUSG00000021910. [Q80TM9-7]
ENSMUST00000172142; ENSMUSP00000132413; ENSMUSG00000021910. [Q80TM9-6]
GeneIDi64652.
KEGGimmu:64652.
UCSCiuc007swy.1. mouse. [Q80TM9-1]
uc007sxa.1. mouse. [Q80TM9-6]
uc007sxb.1. mouse. [Q80TM9-4]
uc007sxc.1. mouse. [Q80TM9-7]

Organism-specific databases

CTDi11188.
MGIiMGI:1928323. Nisch.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1259. Eukaryota.
ENOG410XQUS. LUCA.
GeneTreeiENSGT00530000063625.
HOVERGENiHBG108189.
InParanoidiQ80TM9.
OMAiYSGNIEW.
OrthoDBiEOG091G0707.
PhylomeDBiQ80TM9.
TreeFamiTF320547.

Miscellaneous databases

ChiTaRSiNisch. mouse.
PROiQ80TM9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021910.
ExpressionAtlasiQ80TM9. baseline and differential.
GenevisibleiQ80TM9. MM.

Family and domain databases

Gene3Di3.30.1520.10. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001683. Phox.
[Graphical view]
PfamiPF12799. LRR_4. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
SMARTiSM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF64268. SSF64268. 1 hit.
PROSITEiPS51450. LRR. 6 hits.
PS50195. PX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNISCH_MOUSE
AccessioniPrimary (citable) accession number: Q80TM9
Secondary accession number(s): Q2YDV7
, Q8C354, Q8C4X9, Q8CBH0, Q91XW6, Q99LG6, Q9EPW8, Q9WUM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: September 2, 2008
Last modified: November 2, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

'Nischarin' means 'slowness of motion' in classic Sanskrit.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.