Q80TH2 (LAP2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein LAP2 Alternative name(s): Densin-180-like protein Erbb2-interacting protein Short name=Erbin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1402 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state By similarity. |
| Subunit structure | Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin. Interacts (via C-terminus) with DST (via N-terminus) By similarity. |
| Subcellular location | Cell junction › hemidesmosome By similarity. Nucleus membrane. Note: Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane By similarity. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. Ref.8 |
| Post-translational modification | Isoform 2 is phosphorylated on Ser-1231 and Ser-1234. |
| Sequence similarities | Belongs to the LAP (LRR and PDZ) protein family. Contains 17 LRR (leucine-rich) repeats. Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence BAC65755.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Membrane Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Leucine-rich repeat Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein targeting Inferred from direct assay Ref.5. Source: MGI |
| Cellular_component | basolateral plasma membrane Inferred from direct assay Ref.5. Source: MGI cytoplasmInferred from electronic annotation. Source: Compara hemidesmosomeInferred from electronic annotation. Source: UniProtKB-SubCell nuclear membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: Q80TH2-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q80TH2-1) The sequence of this isoform differs from the canonical sequence as follows: 1243-1268: Missing. | ||||||
| Isoform 2 (identifier: Q80TH2-2) The sequence of this isoform differs from the canonical sequence as follows: 1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR | ||||||
| Note: Contains a phosphoserine at position 1231. Contains a phosphoserine at position 1234. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1402 | 1402 | Protein LAP2 | PRO_0000188302 | |||||
Regions | |||||||||
| Repeat | 23 – 44 | 22 | LRR 1 | ||||||
| Repeat | 47 – 68 | 22 | LRR 2 | ||||||
| Repeat | 70 – 91 | 22 | LRR 3 | ||||||
| Repeat | 93 – 114 | 22 | LRR 4 | ||||||
| Repeat | 116 – 137 | 22 | LRR 5 | ||||||
| Repeat | 139 – 161 | 23 | LRR 6 | ||||||
| Repeat | 162 – 183 | 22 | LRR 7 | ||||||
| Repeat | 185 – 206 | 22 | LRR 8 | ||||||
| Repeat | 208 – 229 | 22 | LRR 9 | ||||||
| Repeat | 231 – 252 | 22 | LRR 10 | ||||||
| Repeat | 254 – 275 | 22 | LRR 11 | ||||||
| Repeat | 277 – 298 | 22 | LRR 12 | ||||||
| Repeat | 300 – 321 | 22 | LRR 13 | ||||||
| Repeat | 323 – 344 | 22 | LRR 14 | ||||||
| Repeat | 346 – 367 | 22 | LRR 15 | ||||||
| Repeat | 369 – 391 | 23 | LRR 16 | ||||||
| Repeat | 392 – 413 | 22 | LRR 17 | ||||||
| Domain | 1311 – 1400 | 90 | PDZ | ||||||
| Compositional bias | 928 – 931 | 4 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 440 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 595 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 599 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 600 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 712 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 850 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 854 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 869 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 914 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 917 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 928 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 970 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 1097 | 1 | Phosphotyrosine Ref.6 | ||||||
| Modified residue | 1150 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1171 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 1276 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1203 | 1 | K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. | VSP_010808 | |||||
| Alternative sequence | 1243 – 1268 | 26 | Missing in isoform 1. | VSP_010809 | |||||
Experimental info | |||||||||
| Sequence conflict | 255 | 1 | L → P in BAC65755. Ref.1 | ||||||
| Sequence conflict | 721 – 723 | 3 | DKK → HAS in AAH28256. Ref.4 | ||||||
| Sequence conflict | 908 – 910 | 3 | VRS → ASG in AAF77047. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 308-1376 (ISOFORMS 2 AND 3). Strain: C57BL/6J. Tissue: Skin and Spinal ganglion. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1402 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1160-1402 (ISOFORM 1). Tissue: Colon and Mammary tumor. |
| [5] | "ERBIN: a basolateral PDZ protein that interacts with the mammalian ERBB2/HER2 receptor." Borg J.-P., Marchetto S., Le Bivic A., Ollendorff V., Jaulin-Bastard F., Saito H., Fournier E., Adelaide J., Margolis B., Birnbaum D. Nat. Cell Biol. 2:407-414(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 908-1402 (ISOFORM 3). |
| [6] | "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling." Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R. J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1097, MASS SPECTROMETRY. Tissue: Mast cell. |
| [7] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-850, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1231 AND SER-1234 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes." Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D. Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-595; SER-599; SER-600; SER-712; SER-869 AND SER-1171, MASS SPECTROMETRY. Tissue: Melanoma. |
| [10] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599; SER-600; SER-712; SER-854 AND SER-1276, MASS SPECTROMETRY. Tissue: Macrophage. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK122473 mRNA. Translation: BAC65755.1. Different initiation. AC154310 Genomic DNA. No translation available. CT009728 Genomic DNA. No translation available. AK029054 mRNA. Translation: BAC26267.1. AK051733 mRNA. Translation: BAC34742.1. BC005691 mRNA. Translation: AAH05691.3. BC028256 mRNA. Translation: AAH28256.1. AF263743 mRNA. Translation: AAF77047.1. |
| IPI | IPI00454041. IPI00457485. IPI00896710. |
| RefSeq | NP_001005868.1. NM_001005868.1. NP_067538.2. NM_021563.2. |
| UniGene | Mm.277354. |
3D structure databases | |
| ProteinModelPortal | Q80TH2. |
| SMR | Q80TH2. Positions 24-404, 1273-1402. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-138078. |
PTM databases | |
| PhosphoSite | Q80TH2. |
Proteomic databases | |
| PaxDb | Q80TH2. |
| PRIDE | Q80TH2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709. ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709. ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709. |
| GeneID | 59079. |
| KEGG | mmu:59079. |
| UCSC | uc007rsk.2. mouse. uc007rsm.1. mouse. |
Organism-specific databases | |
| CTD | 55914. |
| MGI | MGI:1890169. Erbb2ip. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | COG4886. |
| GeneTree | ENSGT00650000093182. |
| HOVERGEN | HBG052305. |
| KO | K12796. |
| OMA | HNNVRAN. |
| OrthoDB | EOG41JZBG. |
Gene expression databases | |
| ArrayExpress | Q80TH2. |
| Bgee | Q80TH2. |
| CleanEx | MM_ERBB2IP. |
| Genevestigator | Q80TH2. |
| GermOnline | ENSMUSG00000021709. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001611. Leu-rich_rpt. IPR025875. Leu-rich_rpt_4. IPR001478. PDZ. [Graphical view] |
| Pfam | PF12799. LRR_4. 2 hits. PF00595. PDZ. 1 hit. [Graphical view] |
| SMART | SM00228. PDZ. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 1 hit. |
| PROSITE | PS51450. LRR. 13 hits. PS50106. PDZ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 314720. |
| SOURCE | Search... |
Entry information
| Entry name | LAP2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q80TH2 Secondary accession number(s): E9QND6 Q9JI47 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
