Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q80TH2

- LAP2_MOUSE

UniProt

Q80TH2 - LAP2_MOUSE

Protein

Protein LAP2

Gene

Erbb2ip

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: MGI

    GO - Biological processi

    1. protein targeting Source: MGI

    Enzyme and pathway databases

    ReactomeiREACT_188191. Signaling by ERBB2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein LAP2
    Alternative name(s):
    Densin-180-like protein
    Erbb2-interacting protein
    Short name:
    Erbin
    Gene namesi
    Name:Erbb2ip
    Synonyms:Erbin, Kiaa1225, Lap2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:1890169. Erbb2ip.

    Subcellular locationi

    Cell junctionhemidesmosome By similarity. Nucleus membrane 1 Publication
    Note: Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane By similarity. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

    GO - Cellular componenti

    1. basolateral plasma membrane Source: MGI
    2. cytoplasm Source: Ensembl
    3. hemidesmosome Source: UniProtKB-SubCell
    4. nuclear membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Membrane, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14021402Protein LAP2PRO_0000188302Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei440 – 4401PhosphoserineBy similarity
    Modified residuei599 – 5991Phosphoserine2 Publications
    Modified residuei600 – 6001Phosphoserine2 Publications
    Modified residuei712 – 7121Phosphoserine1 Publication
    Modified residuei854 – 8541Phosphoserine1 Publication
    Modified residuei869 – 8691PhosphoserineBy similarity
    Modified residuei914 – 9141PhosphothreonineBy similarity
    Modified residuei917 – 9171PhosphotyrosineBy similarity
    Modified residuei928 – 9281PhosphoserineBy similarity
    Modified residuei970 – 9701PhosphotyrosineBy similarity
    Modified residuei1097 – 10971Phosphotyrosine1 Publication
    Modified residuei1150 – 11501PhosphoserineBy similarity
    Modified residuei1276 – 12761PhosphoserineBy similarity

    Post-translational modificationi

    Isoform 2 is phosphorylated on Ser-1231 and Ser-1234.3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ80TH2.
    PaxDbiQ80TH2.
    PRIDEiQ80TH2.

    PTM databases

    PhosphoSiteiQ80TH2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ80TH2.
    BgeeiQ80TH2.
    CleanExiMM_ERBB2IP.
    GenevestigatoriQ80TH2.

    Interactioni

    Subunit structurei

    Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin. Interacts (via C-terminus) with DST (via N-terminus) By similarity.By similarity

    Protein-protein interaction databases

    BioGridi208523. 1 interaction.
    IntActiQ80TH2. 1 interaction.
    MINTiMINT-138078.

    Structurei

    3D structure databases

    ProteinModelPortaliQ80TH2.
    SMRiQ80TH2. Positions 26-460, 1273-1402.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati23 – 4422LRR 1Add
    BLAST
    Repeati47 – 6822LRR 2Add
    BLAST
    Repeati70 – 9122LRR 3Add
    BLAST
    Repeati93 – 11422LRR 4Add
    BLAST
    Repeati116 – 13722LRR 5Add
    BLAST
    Repeati139 – 16123LRR 6Add
    BLAST
    Repeati162 – 18322LRR 7Add
    BLAST
    Repeati185 – 20622LRR 8Add
    BLAST
    Repeati208 – 22922LRR 9Add
    BLAST
    Repeati231 – 25222LRR 10Add
    BLAST
    Repeati254 – 27522LRR 11Add
    BLAST
    Repeati277 – 29822LRR 12Add
    BLAST
    Repeati300 – 32122LRR 13Add
    BLAST
    Repeati323 – 34422LRR 14Add
    BLAST
    Repeati346 – 36722LRR 15Add
    BLAST
    Repeati369 – 39123LRR 16Add
    BLAST
    Repeati392 – 41322LRR 17Add
    BLAST
    Domaini1311 – 140090PDZPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi928 – 9314Poly-Ser

    Sequence similaritiesi

    Belongs to the LAP (LRR and PDZ) protein family.Curated
    Contains 17 LRR (leucine-rich) repeats.Curated
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Leucine-rich repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG4886.
    GeneTreeiENSGT00750000117705.
    HOVERGENiHBG052305.
    KOiK12796.
    OMAiSDEEMKM.
    OrthoDBiEOG72C501.
    TreeFamiTF351429.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    InterProiIPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR001478. PDZ.
    [Graphical view]
    PfamiPF12799. LRR_4. 2 hits.
    PF13855. LRR_8. 2 hits.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    PROSITEiPS51450. LRR. 13 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: Q80TH2-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTKRSLFVR LVPCRCLRGE EETVTTLDYS HCSLEQVPKE IFTFEKTLEE     50
    LYLDANQIEE LPKQLFNCQS LHKLSLPDND LTTLPASIAN LINLRELDVS 100
    KNGIQEFPEN IKNCKVLTIV EASVNPISKL PDGFSQLLNL TQLYLNDAFL 150
    EFLPANFGRL TKLQILELRE NQLKMLPKTM NRLTQLERLD LGSNEFTEVP 200
    EVLEQLSGLR EFWMDGNRLT FIPGFIGSLR QLTYLDVSKN NIEMVEEGIS 250
    TCENLQDFLL SSNSLQQLPE TIGSLKNVTT LKIDENQLMY LPDSIGGLRS 300
    IEELDCSFNE IEALPSSIGQ LTNMRTFAAD HNYLQQLPPE IGNWKNITVL 350
    FLHCNKLETL PEEMGDMQKL KVINLSDNRL KNLPFSFTKL QQLTAMWLSD 400
    NQSKPLIPLQ KETDTETQKM VLTNYMFPQQ PRTEDVMFIS DNESFNPALW 450
    EEQRKQRAQV AFECDEDKDE REAPPREGNL KRYPTPYPDE LKNMVKTVQT 500
    IVHRLKDEET NEESGRDLKQ HEDQQVVNKD KCVKTSESTT TKSKLDEREK 550
    YMNSVQKMSE PEAETNGGNL PVTASMKLSG NLKHIVNHDD VFEESEELSS 600
    DEEMKMAEMR PPLIESSINQ PKVVALSNNK KDDAKDADSL SDEVTHNSNQ 650
    NNSNCSSPSR MSDSVSLNTD SSQDTSLCSP VKQTPVDSNS KVRQEDENFN 700
    SLLQNGVNLN NSPEEKFKIN DKKDFKLPEY DLNIEEQLVL IEKDIDSKAT 750
    SDDSRQLDHI NMNINKLVTN NIFQPEVMER SKMQDIVLGT GFLSIHPKNE 800
    AEHIENGAKF PNLESINKVN GLCEDTAPSP GRVEPQKASS SADVGISKST 850
    EDLSPQRSGP TGAVVKSHSI TNMETGGLKI YDILGDDGPQ PPSAAVKIAS 900
    AVDGKNIVRS KSATLLYDQP LQVFTAASSS SELLSGTKAV FKFDSNHNPE 950
    EPDIIRAATV SGPQSTPHLY GPPQYNVQYS GSATVKDTLW HPKQNPQIDP 1000
    VSFPPQRLPR SESAENHSYA KHSANMNFSN HNNVRANTGY HLQQRLAPAR 1050
    HGEMWAISPN DRLVPAVTRT TIQRQSSVSS TASVNLGDPT RRTEGDYLSY 1100
    RELHSMGRTP VMSGSQRPLS ARAYSIDGPN TSRPQSARPS INEIPERTMS 1150
    VSDFNYSRTS PSKRPNTRVG SEHSLLDPPG KSKVPHDWRE QVLRHIEAKK 1200
    LEKHPQTSSP GECCQDDRFM SEEQNHPSGA LSHRGLPDSL MKMPLSNGQM 1250
    GQPLRPQAHY SQTHHPPQAS VARHPSREQL IDYLMLKVAH QPPYTHPHCS 1300
    PRQGHELAKQ EIRVRVEKDP ELGFSISGGV GGRGNPFRPD DDGIFVTRVQ 1350
    PEGPASKLLQ PGDKIIQANG YSFINIEHGQ AVSLLKTFHN AVDLIIVREV 1400
    SS 1402
    Length:1,402
    Mass (Da):157,248
    Last modified:July 27, 2011 - v3
    Checksum:iDBAFF4BD1BC48019
    GO
    Isoform 1 (identifier: Q80TH2-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1243-1268: Missing.

    Show »
    Length:1,376
    Mass (Da):154,328
    Checksum:i97A2B69F116DB166
    GO
    Isoform 2 (identifier: Q80TH2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR

    Show »
    Length:1,450
    Mass (Da):162,183
    Checksum:i4D8113A7636EE4DC
    GO

    Sequence cautioni

    The sequence BAC65755.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti255 – 2551L → P in BAC65755. (PubMed:12693553)Curated
    Sequence conflicti721 – 7233DKK → HAS in AAH28256. (PubMed:15489334)Curated
    Sequence conflicti908 – 9103VRS → ASG in AAF77047. (PubMed:10878805)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1203 – 12031K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. 2 PublicationsVSP_010808
    Alternative sequencei1243 – 126826Missing in isoform 1. 2 PublicationsVSP_010809Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK122473 mRNA. Translation: BAC65755.1. Different initiation.
    AC154310 Genomic DNA. No translation available.
    CT009728 Genomic DNA. No translation available.
    AK029054 mRNA. Translation: BAC26267.1.
    AK051733 mRNA. Translation: BAC34742.1.
    BC005691 mRNA. Translation: AAH05691.3.
    BC028256 mRNA. Translation: AAH28256.1.
    AF263743 mRNA. Translation: AAF77047.1.
    CCDSiCCDS26744.1. [Q80TH2-2]
    RefSeqiNP_001005868.1. NM_001005868.2. [Q80TH2-2]
    NP_001276402.1. NM_001289473.1. [Q80TH2-3]
    NP_001276403.1. NM_001289474.1.
    NP_001276404.1. NM_001289475.1.
    UniGeneiMm.277354.

    Genome annotation databases

    EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709. [Q80TH2-1]
    ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709. [Q80TH2-2]
    ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709. [Q80TH2-3]
    GeneIDi59079.
    KEGGimmu:59079.
    UCSCiuc007rsk.2. mouse. [Q80TH2-3]
    uc007rsm.1. mouse. [Q80TH2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK122473 mRNA. Translation: BAC65755.1 . Different initiation.
    AC154310 Genomic DNA. No translation available.
    CT009728 Genomic DNA. No translation available.
    AK029054 mRNA. Translation: BAC26267.1 .
    AK051733 mRNA. Translation: BAC34742.1 .
    BC005691 mRNA. Translation: AAH05691.3 .
    BC028256 mRNA. Translation: AAH28256.1 .
    AF263743 mRNA. Translation: AAF77047.1 .
    CCDSi CCDS26744.1. [Q80TH2-2 ]
    RefSeqi NP_001005868.1. NM_001005868.2. [Q80TH2-2 ]
    NP_001276402.1. NM_001289473.1. [Q80TH2-3 ]
    NP_001276403.1. NM_001289474.1.
    NP_001276404.1. NM_001289475.1.
    UniGenei Mm.277354.

    3D structure databases

    ProteinModelPortali Q80TH2.
    SMRi Q80TH2. Positions 26-460, 1273-1402.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 208523. 1 interaction.
    IntActi Q80TH2. 1 interaction.
    MINTi MINT-138078.

    PTM databases

    PhosphoSitei Q80TH2.

    Proteomic databases

    MaxQBi Q80TH2.
    PaxDbi Q80TH2.
    PRIDEi Q80TH2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000022222 ; ENSMUSP00000022222 ; ENSMUSG00000021709 . [Q80TH2-1 ]
    ENSMUST00000053927 ; ENSMUSP00000057956 ; ENSMUSG00000021709 . [Q80TH2-2 ]
    ENSMUST00000091269 ; ENSMUSP00000088813 ; ENSMUSG00000021709 . [Q80TH2-3 ]
    GeneIDi 59079.
    KEGGi mmu:59079.
    UCSCi uc007rsk.2. mouse. [Q80TH2-3 ]
    uc007rsm.1. mouse. [Q80TH2-1 ]

    Organism-specific databases

    CTDi 55914.
    MGIi MGI:1890169. Erbb2ip.
    Rougei Search...

    Phylogenomic databases

    eggNOGi COG4886.
    GeneTreei ENSGT00750000117705.
    HOVERGENi HBG052305.
    KOi K12796.
    OMAi SDEEMKM.
    OrthoDBi EOG72C501.
    TreeFami TF351429.

    Enzyme and pathway databases

    Reactomei REACT_188191. Signaling by ERBB2.

    Miscellaneous databases

    NextBioi 314720.
    PROi Q80TH2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q80TH2.
    Bgeei Q80TH2.
    CleanExi MM_ERBB2IP.
    Genevestigatori Q80TH2.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    InterProi IPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR001478. PDZ.
    [Graphical view ]
    Pfami PF12799. LRR_4. 2 hits.
    PF13855. LRR_8. 2 hits.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    PROSITEi PS51450. LRR. 13 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 308-1376 (ISOFORMS 2 AND 3).
      Strain: C57BL/6J.
      Tissue: Skin and Spinal ganglion.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1402 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1160-1402 (ISOFORM 1).
      Tissue: Colon and Mammary tumor.
    5. "ERBIN: a basolateral PDZ protein that interacts with the mammalian ERBB2/HER2 receptor."
      Borg J.-P., Marchetto S., Le Bivic A., Ollendorff V., Jaulin-Bastard F., Saito H., Fournier E., Adelaide J., Margolis B., Birnbaum D.
      Nat. Cell Biol. 2:407-414(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 908-1402 (ISOFORM 3).
    6. "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling."
      Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R.
      J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1097, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Mast cell.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599 AND SER-600, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    8. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
      Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
      Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    9. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599; SER-600; SER-712 AND SER-854, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiLAP2_MOUSE
    AccessioniPrimary (citable) accession number: Q80TH2
    Secondary accession number(s): E9QND6
    , Q8BQ14, Q8CE41, Q8K171, Q99JU3, Q9JI47
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 116 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3