Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein LAP2

Gene

Erbb2ip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state (By similarity). Inhibits NOD2-dependent NF-kappa-B signaling and proinflammatory cytokine secretion (PubMed:16203728).By similarity1 Publication

GO - Molecular functioni

  1. integrin binding Source: MGI

GO - Biological processi

  1. protein targeting Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_348099. Signaling by ERBB2.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein LAP2
Alternative name(s):
Densin-180-like protein
Erbb2-interacting protein
Short name:
Erbin
Gene namesi
Name:Erbb2ip
Synonyms:Erbin, Kiaa1225, Lap2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1890169. Erbb2ip.

Subcellular locationi

  1. Cell junctionhemidesmosome By similarity
  2. Nucleus membrane 1 Publication
  3. Basolateral cell membrane 1 Publication

  4. Note: Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane (By similarity). Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.By similarity

GO - Cellular componenti

  1. basolateral plasma membrane Source: MGI
  2. cell junction Source: MGI
  3. cytoplasm Source: MGI
  4. hemidesmosome Source: MGI
  5. nuclear membrane Source: UniProtKB-SubCell
  6. nucleoplasm Source: MGI
  7. nucleus Source: MGI
  8. plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi315 – 3151P → L: Decreases interaction with NOD2. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14021402Protein LAP2PRO_0000188302Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei440 – 4401PhosphoserineBy similarity
Modified residuei485 – 4851PhosphothreonineBy similarity
Modified residuei599 – 5991Phosphoserine2 Publications
Modified residuei600 – 6001Phosphoserine2 Publications
Modified residuei712 – 7121Phosphoserine1 Publication
Modified residuei849 – 8491PhosphoserineBy similarity
Modified residuei854 – 8541Phosphoserine1 Publication
Modified residuei869 – 8691PhosphoserineBy similarity
Modified residuei914 – 9141PhosphothreonineBy similarity
Modified residuei917 – 9171PhosphotyrosineBy similarity
Modified residuei928 – 9281PhosphoserineBy similarity
Modified residuei970 – 9701PhosphotyrosineBy similarity
Modified residuei1097 – 10971Phosphotyrosine1 Publication
Modified residuei1150 – 11501PhosphoserineBy similarity
Modified residuei1276 – 12761PhosphoserineBy similarity

Post-translational modificationi

Isoform 2 is phosphorylated on Ser-1231 and Ser-1234.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ80TH2.
PaxDbiQ80TH2.
PRIDEiQ80TH2.

PTM databases

PhosphoSiteiQ80TH2.

Expressioni

Gene expression databases

BgeeiQ80TH2.
CleanExiMM_ERBB2IP.
ExpressionAtlasiQ80TH2. baseline and differential.
GenevestigatoriQ80TH2.

Interactioni

Subunit structurei

Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin. Interacts (via C-terminus) with DST (via N-terminus) (By similarity). Interacts with NOD2 (via CARD domain) (PubMed:16203728).By similarity1 Publication

Protein-protein interaction databases

BioGridi208523. 1 interaction.
IntActiQ80TH2. 1 interaction.
MINTiMINT-138078.

Structurei

3D structure databases

ProteinModelPortaliQ80TH2.
SMRiQ80TH2. Positions 26-460, 1273-1402.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 4422LRR 1Add
BLAST
Repeati47 – 6822LRR 2Add
BLAST
Repeati70 – 9122LRR 3Add
BLAST
Repeati93 – 11422LRR 4Add
BLAST
Repeati116 – 13722LRR 5Add
BLAST
Repeati139 – 16123LRR 6Add
BLAST
Repeati162 – 18322LRR 7Add
BLAST
Repeati185 – 20622LRR 8Add
BLAST
Repeati208 – 22922LRR 9Add
BLAST
Repeati231 – 25222LRR 10Add
BLAST
Repeati254 – 27522LRR 11Add
BLAST
Repeati277 – 29822LRR 12Add
BLAST
Repeati300 – 32122LRR 13Add
BLAST
Repeati323 – 34422LRR 14Add
BLAST
Repeati346 – 36722LRR 15Add
BLAST
Repeati369 – 39123LRR 16Add
BLAST
Repeati392 – 41322LRR 17Add
BLAST
Domaini1311 – 140090PDZPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi928 – 9314Poly-Ser

Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated
Contains 17 LRR (leucine-rich) repeats.Curated
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiCOG4886.
GeneTreeiENSGT00780000121846.
HOVERGENiHBG052305.
InParanoidiQ80TH2.
KOiK12796.
OMAiSDEEMKM.
OrthoDBiEOG72C501.
TreeFamiTF351429.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view]
PfamiPF12799. LRR_4. 2 hits.
PF13855. LRR_8. 2 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 13 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q80TH2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTKRSLFVR LVPCRCLRGE EETVTTLDYS HCSLEQVPKE IFTFEKTLEE
60 70 80 90 100
LYLDANQIEE LPKQLFNCQS LHKLSLPDND LTTLPASIAN LINLRELDVS
110 120 130 140 150
KNGIQEFPEN IKNCKVLTIV EASVNPISKL PDGFSQLLNL TQLYLNDAFL
160 170 180 190 200
EFLPANFGRL TKLQILELRE NQLKMLPKTM NRLTQLERLD LGSNEFTEVP
210 220 230 240 250
EVLEQLSGLR EFWMDGNRLT FIPGFIGSLR QLTYLDVSKN NIEMVEEGIS
260 270 280 290 300
TCENLQDFLL SSNSLQQLPE TIGSLKNVTT LKIDENQLMY LPDSIGGLRS
310 320 330 340 350
IEELDCSFNE IEALPSSIGQ LTNMRTFAAD HNYLQQLPPE IGNWKNITVL
360 370 380 390 400
FLHCNKLETL PEEMGDMQKL KVINLSDNRL KNLPFSFTKL QQLTAMWLSD
410 420 430 440 450
NQSKPLIPLQ KETDTETQKM VLTNYMFPQQ PRTEDVMFIS DNESFNPALW
460 470 480 490 500
EEQRKQRAQV AFECDEDKDE REAPPREGNL KRYPTPYPDE LKNMVKTVQT
510 520 530 540 550
IVHRLKDEET NEESGRDLKQ HEDQQVVNKD KCVKTSESTT TKSKLDEREK
560 570 580 590 600
YMNSVQKMSE PEAETNGGNL PVTASMKLSG NLKHIVNHDD VFEESEELSS
610 620 630 640 650
DEEMKMAEMR PPLIESSINQ PKVVALSNNK KDDAKDADSL SDEVTHNSNQ
660 670 680 690 700
NNSNCSSPSR MSDSVSLNTD SSQDTSLCSP VKQTPVDSNS KVRQEDENFN
710 720 730 740 750
SLLQNGVNLN NSPEEKFKIN DKKDFKLPEY DLNIEEQLVL IEKDIDSKAT
760 770 780 790 800
SDDSRQLDHI NMNINKLVTN NIFQPEVMER SKMQDIVLGT GFLSIHPKNE
810 820 830 840 850
AEHIENGAKF PNLESINKVN GLCEDTAPSP GRVEPQKASS SADVGISKST
860 870 880 890 900
EDLSPQRSGP TGAVVKSHSI TNMETGGLKI YDILGDDGPQ PPSAAVKIAS
910 920 930 940 950
AVDGKNIVRS KSATLLYDQP LQVFTAASSS SELLSGTKAV FKFDSNHNPE
960 970 980 990 1000
EPDIIRAATV SGPQSTPHLY GPPQYNVQYS GSATVKDTLW HPKQNPQIDP
1010 1020 1030 1040 1050
VSFPPQRLPR SESAENHSYA KHSANMNFSN HNNVRANTGY HLQQRLAPAR
1060 1070 1080 1090 1100
HGEMWAISPN DRLVPAVTRT TIQRQSSVSS TASVNLGDPT RRTEGDYLSY
1110 1120 1130 1140 1150
RELHSMGRTP VMSGSQRPLS ARAYSIDGPN TSRPQSARPS INEIPERTMS
1160 1170 1180 1190 1200
VSDFNYSRTS PSKRPNTRVG SEHSLLDPPG KSKVPHDWRE QVLRHIEAKK
1210 1220 1230 1240 1250
LEKHPQTSSP GECCQDDRFM SEEQNHPSGA LSHRGLPDSL MKMPLSNGQM
1260 1270 1280 1290 1300
GQPLRPQAHY SQTHHPPQAS VARHPSREQL IDYLMLKVAH QPPYTHPHCS
1310 1320 1330 1340 1350
PRQGHELAKQ EIRVRVEKDP ELGFSISGGV GGRGNPFRPD DDGIFVTRVQ
1360 1370 1380 1390 1400
PEGPASKLLQ PGDKIIQANG YSFINIEHGQ AVSLLKTFHN AVDLIIVREV

SS
Length:1,402
Mass (Da):157,248
Last modified:July 27, 2011 - v3
Checksum:iDBAFF4BD1BC48019
GO
Isoform 1 (identifier: Q80TH2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1243-1268: Missing.

Show »
Length:1,376
Mass (Da):154,328
Checksum:i97A2B69F116DB166
GO
Isoform 2 (identifier: Q80TH2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR

Show »
Length:1,450
Mass (Da):162,183
Checksum:i4D8113A7636EE4DC
GO

Sequence cautioni

The sequence BAC65755.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti255 – 2551L → P in BAC65755 (PubMed:12693553).Curated
Sequence conflicti721 – 7233DKK → HAS in AAH28256 (PubMed:15489334).Curated
Sequence conflicti908 – 9103VRS → ASG in AAF77047 (PubMed:10878805).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1203 – 12031K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. 2 PublicationsVSP_010808
Alternative sequencei1243 – 126826Missing in isoform 1. 2 PublicationsVSP_010809Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122473 mRNA. Translation: BAC65755.1. Different initiation.
AC154310 Genomic DNA. No translation available.
CT009728 Genomic DNA. No translation available.
AK029054 mRNA. Translation: BAC26267.1.
AK051733 mRNA. Translation: BAC34742.1.
BC005691 mRNA. Translation: AAH05691.3.
BC028256 mRNA. Translation: AAH28256.1.
AF263743 mRNA. Translation: AAF77047.1.
CCDSiCCDS26744.1. [Q80TH2-2]
RefSeqiNP_001005868.1. NM_001005868.2. [Q80TH2-2]
NP_001276402.1. NM_001289473.1. [Q80TH2-3]
NP_001276403.1. NM_001289474.1.
NP_001276404.1. NM_001289475.1.
UniGeneiMm.277354.

Genome annotation databases

EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709. [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709. [Q80TH2-1]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709. [Q80TH2-3]
ENSMUST00000191275; ENSMUSP00000140536; ENSMUSG00000021709. [Q80TH2-2]
GeneIDi59079.
KEGGimmu:59079.
UCSCiuc007rsk.2. mouse. [Q80TH2-3]
uc007rsm.1. mouse. [Q80TH2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122473 mRNA. Translation: BAC65755.1. Different initiation.
AC154310 Genomic DNA. No translation available.
CT009728 Genomic DNA. No translation available.
AK029054 mRNA. Translation: BAC26267.1.
AK051733 mRNA. Translation: BAC34742.1.
BC005691 mRNA. Translation: AAH05691.3.
BC028256 mRNA. Translation: AAH28256.1.
AF263743 mRNA. Translation: AAF77047.1.
CCDSiCCDS26744.1. [Q80TH2-2]
RefSeqiNP_001005868.1. NM_001005868.2. [Q80TH2-2]
NP_001276402.1. NM_001289473.1. [Q80TH2-3]
NP_001276403.1. NM_001289474.1.
NP_001276404.1. NM_001289475.1.
UniGeneiMm.277354.

3D structure databases

ProteinModelPortaliQ80TH2.
SMRiQ80TH2. Positions 26-460, 1273-1402.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208523. 1 interaction.
IntActiQ80TH2. 1 interaction.
MINTiMINT-138078.

PTM databases

PhosphoSiteiQ80TH2.

Proteomic databases

MaxQBiQ80TH2.
PaxDbiQ80TH2.
PRIDEiQ80TH2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709. [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709. [Q80TH2-1]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709. [Q80TH2-3]
ENSMUST00000191275; ENSMUSP00000140536; ENSMUSG00000021709. [Q80TH2-2]
GeneIDi59079.
KEGGimmu:59079.
UCSCiuc007rsk.2. mouse. [Q80TH2-3]
uc007rsm.1. mouse. [Q80TH2-1]

Organism-specific databases

CTDi55914.
MGIiMGI:1890169. Erbb2ip.
RougeiSearch...

Phylogenomic databases

eggNOGiCOG4886.
GeneTreeiENSGT00780000121846.
HOVERGENiHBG052305.
InParanoidiQ80TH2.
KOiK12796.
OMAiSDEEMKM.
OrthoDBiEOG72C501.
TreeFamiTF351429.

Enzyme and pathway databases

ReactomeiREACT_348099. Signaling by ERBB2.

Miscellaneous databases

NextBioi314720.
PROiQ80TH2.
SOURCEiSearch...

Gene expression databases

BgeeiQ80TH2.
CleanExiMM_ERBB2IP.
ExpressionAtlasiQ80TH2. baseline and differential.
GenevestigatoriQ80TH2.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view]
PfamiPF12799. LRR_4. 2 hits.
PF13855. LRR_8. 2 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 13 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 308-1376 (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Skin and Spinal ganglion.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1402 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1160-1402 (ISOFORM 1).
    Tissue: Colon and Mammary tumor.
  5. "ERBIN: a basolateral PDZ protein that interacts with the mammalian ERBB2/HER2 receptor."
    Borg J.-P., Marchetto S., Le Bivic A., Ollendorff V., Jaulin-Bastard F., Saito H., Fournier E., Adelaide J., Margolis B., Birnbaum D.
    Nat. Cell Biol. 2:407-414(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 908-1402 (ISOFORM 3).
  6. "A role for Erbin in the regulation of Nod2-dependent NF-kappaB signaling."
    McDonald C., Chen F.F., Ollendorff V., Ogura Y., Marchetto S., Lecine P., Borg J.P., Nunez G.
    J. Biol. Chem. 280:40301-40309(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH NOD2, SUBCELLULAR LOCATION, MUTAGENESIS OF PRO-315.
  7. "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling."
    Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R.
    J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1097, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Mast cell.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599 AND SER-600, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  9. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  10. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599; SER-600; SER-712 AND SER-854, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiLAP2_MOUSE
AccessioniPrimary (citable) accession number: Q80TH2
Secondary accession number(s): E9QND6
, Q8BQ14, Q8CE41, Q8K171, Q99JU3, Q9JI47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 27, 2011
Last modified: April 29, 2015
This is version 122 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.