SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q80TH2

- LAP2_MOUSE

UniProt

Q80TH2 - LAP2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein LAP2

Gene
Erbb2ip, Erbin, Kiaa1225, Lap2
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state By similarity.

GO - Molecular functioni

  1. protein binding Source: MGI

GO - Biological processi

  1. protein targeting Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_188191. Signaling by ERBB2.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein LAP2
Alternative name(s):
Densin-180-like protein
Erbb2-interacting protein
Short name:
Erbin
Gene namesi
Name:Erbb2ip
Synonyms:Erbin, Kiaa1225, Lap2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:1890169. Erbb2ip.

Subcellular locationi

Cell junctionhemidesmosome By similarity. Nucleus membrane
Note: Found in hemidesmosomes, which are cell-substrate adhesion complexes in stratified epithelia. In transfected cells, either diffusely distributed over the cytoplasm or concentrated at the basolateral membrane By similarity. Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes.1 Publication

GO - Cellular componenti

  1. basolateral plasma membrane Source: MGI
  2. cytoplasm Source: Ensembl
  3. hemidesmosome Source: UniProtKB-SubCell
  4. nuclear membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14021402Protein LAP2PRO_0000188302Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei440 – 4401Phosphoserine By similarity
Modified residuei599 – 5991Phosphoserine2 Publications
Modified residuei600 – 6001Phosphoserine2 Publications
Modified residuei712 – 7121Phosphoserine1 Publication
Modified residuei854 – 8541Phosphoserine1 Publication
Modified residuei869 – 8691Phosphoserine By similarity
Modified residuei914 – 9141Phosphothreonine By similarity
Modified residuei917 – 9171Phosphotyrosine By similarity
Modified residuei928 – 9281Phosphoserine By similarity
Modified residuei970 – 9701Phosphotyrosine By similarity
Modified residuei1097 – 10971Phosphotyrosine1 Publication
Modified residuei1150 – 11501Phosphoserine By similarity
Modified residuei1276 – 12761Phosphoserine By similarity

Post-translational modificationi

Isoform 2 is phosphorylated on Ser-1231 and Ser-1234.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ80TH2.
PaxDbiQ80TH2.
PRIDEiQ80TH2.

PTM databases

PhosphoSiteiQ80TH2.

Expressioni

Gene expression databases

ArrayExpressiQ80TH2.
BgeeiQ80TH2.
CleanExiMM_ERBB2IP.
GenevestigatoriQ80TH2.

Interactioni

Subunit structurei

Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin. Interacts (via C-terminus) with DST (via N-terminus) By similarity.

Protein-protein interaction databases

BioGridi208523. 1 interaction.
IntActiQ80TH2. 1 interaction.
MINTiMINT-138078.

Structurei

3D structure databases

ProteinModelPortaliQ80TH2.
SMRiQ80TH2. Positions 26-460, 1273-1402.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 4422LRR 1Add
BLAST
Repeati47 – 6822LRR 2Add
BLAST
Repeati70 – 9122LRR 3Add
BLAST
Repeati93 – 11422LRR 4Add
BLAST
Repeati116 – 13722LRR 5Add
BLAST
Repeati139 – 16123LRR 6Add
BLAST
Repeati162 – 18322LRR 7Add
BLAST
Repeati185 – 20622LRR 8Add
BLAST
Repeati208 – 22922LRR 9Add
BLAST
Repeati231 – 25222LRR 10Add
BLAST
Repeati254 – 27522LRR 11Add
BLAST
Repeati277 – 29822LRR 12Add
BLAST
Repeati300 – 32122LRR 13Add
BLAST
Repeati323 – 34422LRR 14Add
BLAST
Repeati346 – 36722LRR 15Add
BLAST
Repeati369 – 39123LRR 16Add
BLAST
Repeati392 – 41322LRR 17Add
BLAST
Domaini1311 – 140090PDZAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi928 – 9314Poly-Ser

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiCOG4886.
GeneTreeiENSGT00750000117705.
HOVERGENiHBG052305.
KOiK12796.
OMAiSDEEMKM.
OrthoDBiEOG72C501.
TreeFamiTF351429.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view]
PfamiPF12799. LRR_4. 2 hits.
PF13855. LRR_8. 2 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 13 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: Q80TH2-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTTKRSLFVR LVPCRCLRGE EETVTTLDYS HCSLEQVPKE IFTFEKTLEE     50
LYLDANQIEE LPKQLFNCQS LHKLSLPDND LTTLPASIAN LINLRELDVS 100
KNGIQEFPEN IKNCKVLTIV EASVNPISKL PDGFSQLLNL TQLYLNDAFL 150
EFLPANFGRL TKLQILELRE NQLKMLPKTM NRLTQLERLD LGSNEFTEVP 200
EVLEQLSGLR EFWMDGNRLT FIPGFIGSLR QLTYLDVSKN NIEMVEEGIS 250
TCENLQDFLL SSNSLQQLPE TIGSLKNVTT LKIDENQLMY LPDSIGGLRS 300
IEELDCSFNE IEALPSSIGQ LTNMRTFAAD HNYLQQLPPE IGNWKNITVL 350
FLHCNKLETL PEEMGDMQKL KVINLSDNRL KNLPFSFTKL QQLTAMWLSD 400
NQSKPLIPLQ KETDTETQKM VLTNYMFPQQ PRTEDVMFIS DNESFNPALW 450
EEQRKQRAQV AFECDEDKDE REAPPREGNL KRYPTPYPDE LKNMVKTVQT 500
IVHRLKDEET NEESGRDLKQ HEDQQVVNKD KCVKTSESTT TKSKLDEREK 550
YMNSVQKMSE PEAETNGGNL PVTASMKLSG NLKHIVNHDD VFEESEELSS 600
DEEMKMAEMR PPLIESSINQ PKVVALSNNK KDDAKDADSL SDEVTHNSNQ 650
NNSNCSSPSR MSDSVSLNTD SSQDTSLCSP VKQTPVDSNS KVRQEDENFN 700
SLLQNGVNLN NSPEEKFKIN DKKDFKLPEY DLNIEEQLVL IEKDIDSKAT 750
SDDSRQLDHI NMNINKLVTN NIFQPEVMER SKMQDIVLGT GFLSIHPKNE 800
AEHIENGAKF PNLESINKVN GLCEDTAPSP GRVEPQKASS SADVGISKST 850
EDLSPQRSGP TGAVVKSHSI TNMETGGLKI YDILGDDGPQ PPSAAVKIAS 900
AVDGKNIVRS KSATLLYDQP LQVFTAASSS SELLSGTKAV FKFDSNHNPE 950
EPDIIRAATV SGPQSTPHLY GPPQYNVQYS GSATVKDTLW HPKQNPQIDP 1000
VSFPPQRLPR SESAENHSYA KHSANMNFSN HNNVRANTGY HLQQRLAPAR 1050
HGEMWAISPN DRLVPAVTRT TIQRQSSVSS TASVNLGDPT RRTEGDYLSY 1100
RELHSMGRTP VMSGSQRPLS ARAYSIDGPN TSRPQSARPS INEIPERTMS 1150
VSDFNYSRTS PSKRPNTRVG SEHSLLDPPG KSKVPHDWRE QVLRHIEAKK 1200
LEKHPQTSSP GECCQDDRFM SEEQNHPSGA LSHRGLPDSL MKMPLSNGQM 1250
GQPLRPQAHY SQTHHPPQAS VARHPSREQL IDYLMLKVAH QPPYTHPHCS 1300
PRQGHELAKQ EIRVRVEKDP ELGFSISGGV GGRGNPFRPD DDGIFVTRVQ 1350
PEGPASKLLQ PGDKIIQANG YSFINIEHGQ AVSLLKTFHN AVDLIIVREV 1400
SS 1402
Length:1,402
Mass (Da):157,248
Last modified:July 27, 2011 - v3
Checksum:iDBAFF4BD1BC48019
GO
Isoform 1 (identifier: Q80TH2-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1243-1268: Missing.

Show »
Length:1,376
Mass (Da):154,328
Checksum:i97A2B69F116DB166
GO
Isoform 2 (identifier: Q80TH2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR

Show »
Length:1,450
Mass (Da):162,183
Checksum:i4D8113A7636EE4DC
GO

Sequence cautioni

The sequence BAC65755.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1203 – 12031K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. VSP_010808
Alternative sequencei1243 – 126826Missing in isoform 1. VSP_010809Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti255 – 2551L → P in BAC65755. 1 Publication
Sequence conflicti721 – 7233DKK → HAS in AAH28256. 1 Publication
Sequence conflicti908 – 9103VRS → ASG in AAF77047. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK122473 mRNA. Translation: BAC65755.1. Different initiation.
AC154310 Genomic DNA. No translation available.
CT009728 Genomic DNA. No translation available.
AK029054 mRNA. Translation: BAC26267.1.
AK051733 mRNA. Translation: BAC34742.1.
BC005691 mRNA. Translation: AAH05691.3.
BC028256 mRNA. Translation: AAH28256.1.
AF263743 mRNA. Translation: AAF77047.1.
CCDSiCCDS26744.1. [Q80TH2-2]
RefSeqiNP_001005868.1. NM_001005868.2. [Q80TH2-2]
NP_001276402.1. NM_001289473.1. [Q80TH2-3]
NP_001276403.1. NM_001289474.1.
NP_001276404.1. NM_001289475.1.
UniGeneiMm.277354.

Genome annotation databases

EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709. [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709. [Q80TH2-2]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709. [Q80TH2-3]
GeneIDi59079.
KEGGimmu:59079.
UCSCiuc007rsk.2. mouse. [Q80TH2-3]
uc007rsm.1. mouse. [Q80TH2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK122473 mRNA. Translation: BAC65755.1 . Different initiation.
AC154310 Genomic DNA. No translation available.
CT009728 Genomic DNA. No translation available.
AK029054 mRNA. Translation: BAC26267.1 .
AK051733 mRNA. Translation: BAC34742.1 .
BC005691 mRNA. Translation: AAH05691.3 .
BC028256 mRNA. Translation: AAH28256.1 .
AF263743 mRNA. Translation: AAF77047.1 .
CCDSi CCDS26744.1. [Q80TH2-2 ]
RefSeqi NP_001005868.1. NM_001005868.2. [Q80TH2-2 ]
NP_001276402.1. NM_001289473.1. [Q80TH2-3 ]
NP_001276403.1. NM_001289474.1.
NP_001276404.1. NM_001289475.1.
UniGenei Mm.277354.

3D structure databases

ProteinModelPortali Q80TH2.
SMRi Q80TH2. Positions 26-460, 1273-1402.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 208523. 1 interaction.
IntActi Q80TH2. 1 interaction.
MINTi MINT-138078.

PTM databases

PhosphoSitei Q80TH2.

Proteomic databases

MaxQBi Q80TH2.
PaxDbi Q80TH2.
PRIDEi Q80TH2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000022222 ; ENSMUSP00000022222 ; ENSMUSG00000021709 . [Q80TH2-1 ]
ENSMUST00000053927 ; ENSMUSP00000057956 ; ENSMUSG00000021709 . [Q80TH2-2 ]
ENSMUST00000091269 ; ENSMUSP00000088813 ; ENSMUSG00000021709 . [Q80TH2-3 ]
GeneIDi 59079.
KEGGi mmu:59079.
UCSCi uc007rsk.2. mouse. [Q80TH2-3 ]
uc007rsm.1. mouse. [Q80TH2-1 ]

Organism-specific databases

CTDi 55914.
MGIi MGI:1890169. Erbb2ip.
Rougei Search...

Phylogenomic databases

eggNOGi COG4886.
GeneTreei ENSGT00750000117705.
HOVERGENi HBG052305.
KOi K12796.
OMAi SDEEMKM.
OrthoDBi EOG72C501.
TreeFami TF351429.

Enzyme and pathway databases

Reactomei REACT_188191. Signaling by ERBB2.

Miscellaneous databases

NextBioi 314720.
PROi Q80TH2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q80TH2.
Bgeei Q80TH2.
CleanExi MM_ERBB2IP.
Genevestigatori Q80TH2.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
InterProi IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view ]
Pfami PF12799. LRR_4. 2 hits.
PF13855. LRR_8. 2 hits.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS51450. LRR. 13 hits.
PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 308-1376 (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Skin and Spinal ganglion.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 721-1402 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1160-1402 (ISOFORM 1).
    Tissue: Colon and Mammary tumor.
  5. "ERBIN: a basolateral PDZ protein that interacts with the mammalian ERBB2/HER2 receptor."
    Borg J.-P., Marchetto S., Le Bivic A., Ollendorff V., Jaulin-Bastard F., Saito H., Fournier E., Adelaide J., Margolis B., Birnbaum D.
    Nat. Cell Biol. 2:407-414(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 908-1402 (ISOFORM 3).
  6. "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling."
    Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R.
    J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-1097, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Mast cell.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599 AND SER-600, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  8. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  9. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-599; SER-600; SER-712 AND SER-854, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiLAP2_MOUSE
AccessioniPrimary (citable) accession number: Q80TH2
Secondary accession number(s): E9QND6
, Q8BQ14, Q8CE41, Q8K171, Q99JU3, Q9JI47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 27, 2011
Last modified: September 3, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi