Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Erbin

Gene

Erbin

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an adapter for the receptor ERBB2, in epithelia. By binding the unphosphorylated ERBB2 'Tyr-1248' receptor, it may contribute to stabilize this unphosphorylated state (By similarity). Inhibits NOD2-dependent NF-kappa-B signaling and proinflammatory cytokine secretion (PubMed:16203728).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-1227986 Signaling by ERBB2
R-MMU-8863795 Downregulation of ERBB2 signaling

Names & Taxonomyi

Protein namesi
Recommended name:
Erbin1 Publication
Alternative name(s):
Densin-180-like protein
Erbb2-interacting protein1 Publication
Protein LAP2
Gene namesi
Name:Erbin1 Publication
Synonyms:Erbb2ipImported, Kiaa1225Imported, Lap2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1890169 Erbin

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi315P → L: Decreases interaction with NOD2. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001883021 – 1402ErbinAdd BLAST1402

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei440PhosphoserineCombined sources1
Modified residuei444PhosphoserineCombined sources1
Modified residuei483PhosphotyrosineCombined sources1
Modified residuei485PhosphothreonineBy similarity1
Modified residuei595PhosphoserineCombined sources1
Modified residuei599PhosphoserineCombined sources1
Modified residuei600PhosphoserineCombined sources1
Modified residuei617PhosphoserineBy similarity1
Modified residuei712PhosphoserineCombined sources1
Modified residuei849PhosphoserineCombined sources1
Modified residuei854PhosphoserineCombined sources1
Modified residuei869PhosphoserineCombined sources1
Modified residuei914PhosphothreonineBy similarity1
Modified residuei917PhosphotyrosineBy similarity1
Modified residuei928PhosphoserineBy similarity1
Modified residuei970PhosphotyrosineBy similarity1
Modified residuei1097PhosphotyrosineCombined sources1
Modified residuei1150PhosphoserineCombined sources1
Modified residuei1171PhosphoserineBy similarity1
Modified residuei1276PhosphoserineBy similarity1
Isoform 2 (identifier: Q80TH2-2)
Modified residuei1231PhosphoserineCombined sources1
Modified residuei1234PhosphoserineCombined sources1

Post-translational modificationi

Isoform 2 is phosphorylated on Ser-1231 and Ser-1234.

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ80TH2
PaxDbiQ80TH2
PRIDEiQ80TH2

PTM databases

iPTMnetiQ80TH2
PhosphoSitePlusiQ80TH2
SwissPalmiQ80TH2

Expressioni

Gene expression databases

BgeeiENSMUSG00000021709
CleanExiMM_ERBB2IP
ExpressionAtlasiQ80TH2 baseline and differential
GenevisibleiQ80TH2 MM

Interactioni

Subunit structurei

Interacts with ERBB2, BPAG1 and ITGB4. May favor the localization of ERBB2, by restricting its presence to the basolateral membrane of epithelial cells. Also found to interact with ARVCF and delta catenin. Interacts (via C-terminus) with DST (via N-terminus) (By similarity). Interacts with NOD2 (via CARD domain) (PubMed:16203728).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi208523, 3 interactors
IntActiQ80TH2, 3 interactors
MINTiQ80TH2
STRINGi10090.ENSMUSP00000057956

Structurei

3D structure databases

ProteinModelPortaliQ80TH2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati23 – 44LRR 1Add BLAST22
Repeati47 – 68LRR 2Add BLAST22
Repeati70 – 91LRR 3Add BLAST22
Repeati93 – 114LRR 4Add BLAST22
Repeati116 – 137LRR 5Add BLAST22
Repeati139 – 161LRR 6Add BLAST23
Repeati162 – 183LRR 7Add BLAST22
Repeati185 – 206LRR 8Add BLAST22
Repeati208 – 229LRR 9Add BLAST22
Repeati231 – 252LRR 10Add BLAST22
Repeati254 – 275LRR 11Add BLAST22
Repeati277 – 298LRR 12Add BLAST22
Repeati300 – 321LRR 13Add BLAST22
Repeati323 – 344LRR 14Add BLAST22
Repeati346 – 367LRR 15Add BLAST22
Repeati369 – 391LRR 16Add BLAST23
Repeati392 – 413LRR 17Add BLAST22
Domaini1311 – 1400PDZPROSITE-ProRule annotationAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi928 – 931Poly-Ser4

Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410KCZ0 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00840000129686
HOVERGENiHBG052305
InParanoidiQ80TH2
KOiK12796
OMAiNMVKTVQ
TreeFamiTF351429

Family and domain databases

Gene3Di3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR032927 Erbin
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR44896 PTHR44896, 1 hit
PfamiView protein in Pfam
PF13855 LRR_8, 4 hits
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00369 LRR_TYP, 12 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 13 hits
PS50106 PDZ, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q80TH2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTKRSLFVR LVPCRCLRGE EETVTTLDYS HCSLEQVPKE IFTFEKTLEE
60 70 80 90 100
LYLDANQIEE LPKQLFNCQS LHKLSLPDND LTTLPASIAN LINLRELDVS
110 120 130 140 150
KNGIQEFPEN IKNCKVLTIV EASVNPISKL PDGFSQLLNL TQLYLNDAFL
160 170 180 190 200
EFLPANFGRL TKLQILELRE NQLKMLPKTM NRLTQLERLD LGSNEFTEVP
210 220 230 240 250
EVLEQLSGLR EFWMDGNRLT FIPGFIGSLR QLTYLDVSKN NIEMVEEGIS
260 270 280 290 300
TCENLQDFLL SSNSLQQLPE TIGSLKNVTT LKIDENQLMY LPDSIGGLRS
310 320 330 340 350
IEELDCSFNE IEALPSSIGQ LTNMRTFAAD HNYLQQLPPE IGNWKNITVL
360 370 380 390 400
FLHCNKLETL PEEMGDMQKL KVINLSDNRL KNLPFSFTKL QQLTAMWLSD
410 420 430 440 450
NQSKPLIPLQ KETDTETQKM VLTNYMFPQQ PRTEDVMFIS DNESFNPALW
460 470 480 490 500
EEQRKQRAQV AFECDEDKDE REAPPREGNL KRYPTPYPDE LKNMVKTVQT
510 520 530 540 550
IVHRLKDEET NEESGRDLKQ HEDQQVVNKD KCVKTSESTT TKSKLDEREK
560 570 580 590 600
YMNSVQKMSE PEAETNGGNL PVTASMKLSG NLKHIVNHDD VFEESEELSS
610 620 630 640 650
DEEMKMAEMR PPLIESSINQ PKVVALSNNK KDDAKDADSL SDEVTHNSNQ
660 670 680 690 700
NNSNCSSPSR MSDSVSLNTD SSQDTSLCSP VKQTPVDSNS KVRQEDENFN
710 720 730 740 750
SLLQNGVNLN NSPEEKFKIN DKKDFKLPEY DLNIEEQLVL IEKDIDSKAT
760 770 780 790 800
SDDSRQLDHI NMNINKLVTN NIFQPEVMER SKMQDIVLGT GFLSIHPKNE
810 820 830 840 850
AEHIENGAKF PNLESINKVN GLCEDTAPSP GRVEPQKASS SADVGISKST
860 870 880 890 900
EDLSPQRSGP TGAVVKSHSI TNMETGGLKI YDILGDDGPQ PPSAAVKIAS
910 920 930 940 950
AVDGKNIVRS KSATLLYDQP LQVFTAASSS SELLSGTKAV FKFDSNHNPE
960 970 980 990 1000
EPDIIRAATV SGPQSTPHLY GPPQYNVQYS GSATVKDTLW HPKQNPQIDP
1010 1020 1030 1040 1050
VSFPPQRLPR SESAENHSYA KHSANMNFSN HNNVRANTGY HLQQRLAPAR
1060 1070 1080 1090 1100
HGEMWAISPN DRLVPAVTRT TIQRQSSVSS TASVNLGDPT RRTEGDYLSY
1110 1120 1130 1140 1150
RELHSMGRTP VMSGSQRPLS ARAYSIDGPN TSRPQSARPS INEIPERTMS
1160 1170 1180 1190 1200
VSDFNYSRTS PSKRPNTRVG SEHSLLDPPG KSKVPHDWRE QVLRHIEAKK
1210 1220 1230 1240 1250
LEKHPQTSSP GECCQDDRFM SEEQNHPSGA LSHRGLPDSL MKMPLSNGQM
1260 1270 1280 1290 1300
GQPLRPQAHY SQTHHPPQAS VARHPSREQL IDYLMLKVAH QPPYTHPHCS
1310 1320 1330 1340 1350
PRQGHELAKQ EIRVRVEKDP ELGFSISGGV GGRGNPFRPD DDGIFVTRVQ
1360 1370 1380 1390 1400
PEGPASKLLQ PGDKIIQANG YSFINIEHGQ AVSLLKTFHN AVDLIIVREV

SS
Length:1,402
Mass (Da):157,248
Last modified:July 27, 2011 - v3
Checksum:iDBAFF4BD1BC48019
GO
Isoform 1 (identifier: Q80TH2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1243-1268: Missing.

Show »
Length:1,376
Mass (Da):154,328
Checksum:i97A2B69F116DB166
GO
Isoform 2 (identifier: Q80TH2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1203-1203: K → KSMLSRSFNSNLTAVSSSHYGSSRDLHGSQGSLALSVADGRGSGGHIFR

Show »
Length:1,450
Mass (Da):162,183
Checksum:i4D8113A7636EE4DC
GO

Sequence cautioni

The sequence BAC65755 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti255L → P in BAC65755 (PubMed:12693553).Curated1
Sequence conflicti721 – 723DKK → HAS in AAH28256 (PubMed:15489334).Curated3
Sequence conflicti908 – 910VRS → ASG in AAF77047 (PubMed:10878805).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0108081203K → KSMLSRSFNSNLTAVSSSHY GSSRDLHGSQGSLALSVADG RGSGGHIFR in isoform 2. 2 Publications1
Alternative sequenceiVSP_0108091243 – 1268Missing in isoform 1. 2 PublicationsAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122473 mRNA Translation: BAC65755.1 Different initiation.
AC154310 Genomic DNA No translation available.
CT009728 Genomic DNA No translation available.
AK029054 mRNA Translation: BAC26267.1
AK051733 mRNA Translation: BAC34742.1
BC005691 mRNA Translation: AAH05691.3
BC028256 mRNA Translation: AAH28256.1
AF263743 mRNA Translation: AAF77047.1
CCDSiCCDS26744.1 [Q80TH2-2]
CCDS79233.1 [Q80TH2-3]
RefSeqiNP_001005868.1, NM_001005868.2 [Q80TH2-2]
NP_001276402.1, NM_001289473.1 [Q80TH2-3]
NP_001276403.1, NM_001289474.1
NP_001276404.1, NM_001289475.1
UniGeneiMm.277354

Genome annotation databases

EnsembliENSMUST00000022222; ENSMUSP00000022222; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000053927; ENSMUSP00000057956; ENSMUSG00000021709 [Q80TH2-1]
ENSMUST00000091269; ENSMUSP00000088813; ENSMUSG00000021709 [Q80TH2-3]
ENSMUST00000191275; ENSMUSP00000140536; ENSMUSG00000021709 [Q80TH2-2]
GeneIDi59079
KEGGimmu:59079
UCSCiuc007rsk.3 mouse [Q80TH2-3]
uc056yux.1 mouse [Q80TH2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiERBIN_MOUSE
AccessioniPrimary (citable) accession number: Q80TH2
Secondary accession number(s): E9QND6
, Q8BQ14, Q8CE41, Q8K171, Q99JU3, Q9JI47
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 27, 2011
Last modified: May 23, 2018
This is version 151 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health