Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 13

Gene

Klhl13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 13
Alternative name(s):
BTB and kelch domain-containing protein 2
Gene namesi
Name:Klhl13
Synonyms:Bklhd2, Kiaa1309
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1914705 Klhl13

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001191161 – 654Kelch-like protein 13Add BLAST654

Proteomic databases

PaxDbiQ80TF4
PRIDEiQ80TF4

PTM databases

iPTMnetiQ80TF4
PhosphoSitePlusiQ80TF4

Expressioni

Gene expression databases

BgeeiENSMUSG00000036782
CleanExiMM_KLHL13
GenevisibleiQ80TF4 MM

Interactioni

Subunit structurei

Component of the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, at least composed of CUL3, KLHL9, KLHL13 and RBX1. Interacts with AURKB (By similarity).By similarity

Protein-protein interaction databases

IntActiQ80TF4, 1 interactor
STRINGi10090.ENSMUSP00000041190

Structurei

3D structure databases

ProteinModelPortaliQ80TF4
SMRiQ80TF4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini91 – 160BTBPROSITE-ProRule annotationAdd BLAST70
Domaini195 – 296BACKAdd BLAST102
Repeati340 – 388Kelch 1Add BLAST49
Repeati389 – 440Kelch 2Add BLAST52
Repeati441 – 487Kelch 3Add BLAST47
Repeati489 – 534Kelch 4Add BLAST46
Repeati536 – 586Kelch 5Add BLAST51
Repeati587 – 635Kelch 6Add BLAST49

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441 Eukaryota
ENOG410XNX8 LUCA
GeneTreeiENSGT00760000118825
HOGENOMiHOG000231583
HOVERGENiHBG106526
InParanoidiQ80TF4
KOiK10447
OMAiGIRACTM
OrthoDBiEOG091G039V
PhylomeDBiQ80TF4
TreeFamiTF328485

Family and domain databases

Gene3Di2.120.10.80, 1 hit
InterProiView protein in InterPro
IPR011705 BACK
IPR017096 BTB-kelch_protein
IPR000210 BTB/POZ_dom
IPR015915 Kelch-typ_b-propeller
IPR006652 Kelch_1
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF01344 Kelch_1, 5 hits
PIRSFiPIRSF037037 Kelch-like_protein_gigaxonin, 1 hit
SMARTiView protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SM00612 Kelch, 6 hits
SUPFAMiSSF117281 SSF117281, 1 hit
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80TF4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLKWKTSSP AIWKFPVPVL KTSRSTPLSP AYISLVEEED QHLKLCLGSE
60 70 80 90 100
MGLSSHLQSC KAGSTRIFTS NSHSSVVLQG FDQLRLDGLL CDVTLMPGDT
110 120 130 140 150
DDAYPVHRVM MASASDYFKA MFTGGMKEQE LMCIKLHGVS RVGLRKIIDF
160 170 180 190 200
IYTAKLSLNM DTLQDTLEAA SFLQILPVLD FCKVFLISGV TLDNCVEVGR
210 220 230 240 250
IANTYHLTEV DKYVNSFVLK NFAALLSTGE FLKLPFERLA FVLSSNSLKR
260 270 280 290 300
CTELDLFKAT CRWLRLEEPR MDVAAKLMKN IRFPLMTPQE LINYVQTVDF
310 320 330 340 350
MRTDNTCVNL LLEASNYQMM PFMQPVMQSD RTAIRSDTTR LVTLGGVLRQ
360 370 380 390 400
QLVVSKELRM YDEKTHEWKS LAPMDAPRYQ HGIAVIGNFL YVVGGQSNYD
410 420 430 440 450
TKGKTAVDTV FRFDPRYNKW IQVASLNEKR TFFHLSALKG FLYAVGGRNA
460 470 480 490 500
AGELPTVECY NPRTNEWTYV AKMNEPHYGH AGTVYGGVMY ISGGITHDTF
510 520 530 540 550
QKELMCFDPD TDKWTQKAPM TTVRGLHCMC TVGDRLYVIG GNHFRGTSDY
560 570 580 590 600
DDVLSCEYYS PILDQWTPIA SMLRGQSDVG VAVFENKIYV VGGYSWNNRC
610 620 630 640 650
MVEIVQKYDP EKNEWHKVFD LPESLGGIRA CTLTVYPPEE ATPSPSRESP

LSGP
Length:654
Mass (Da):73,787
Last modified:June 16, 2009 - v3
Checksum:i33E8497FEF1571D2
GO
Isoform 2 (identifier: Q80TF4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MLRFISHLYCCSSKEECSEDDKCILSR

Show »
Length:648
Mass (Da):73,255
Checksum:i16D6390BD932D6FD
GO
Isoform 3 (identifier: Q80TF4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MDILHRGELVAAILRNR

Show »
Length:638
Mass (Da):72,036
Checksum:i8F302FC2DF961AFF
GO
Isoform 4 (identifier: Q80TF4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MEGEYFFEENPFLEFLLKL

Show »
Length:640
Mass (Da):72,454
Checksum:i7678E0E4D2764598
GO
Isoform 5 (identifier: Q80TF4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.

Show »
Length:604
Mass (Da):68,165
Checksum:i084944B636C1C74B
GO

Sequence cautioni

The sequence BAC65773 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0375341 – 50Missing in isoform 5. CuratedAdd BLAST50
Alternative sequenceiVSP_0375351 – 33MPLKW…SPAYI → MLRFISHLYCCSSKEECSED DKCILSR in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375361 – 33MPLKW…SPAYI → MDILHRGELVAAILRNR in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0375371 – 33MPLKW…SPAYI → MEGEYFFEENPFLEFLLKL in isoform 4. CuratedAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122491 mRNA Translation: BAC65773.1 Different initiation.
AK004677 mRNA Translation: BAB23465.1
AL773552 Genomic DNA No translation available.
CCDSiCCDS40891.1 [Q80TF4-3]
CCDS72348.1 [Q80TF4-2]
CCDS81105.1 [Q80TF4-4]
RefSeqiNP_001277405.1, NM_001290476.2 [Q80TF4-2]
NP_001297395.1, NM_001310466.1 [Q80TF4-4]
NP_080443.1, NM_026167.4 [Q80TF4-3]
XP_011245791.1, XM_011247489.2 [Q80TF4-1]
XP_011245794.1, XM_011247492.2 [Q80TF4-3]
XP_011245795.1, XM_011247493.2 [Q80TF4-3]
XP_011245796.1, XM_011247494.2 [Q80TF4-3]
XP_017174099.1, XM_017318610.1 [Q80TF4-3]
UniGeneiMm.224306

Genome annotation databases

EnsembliENSMUST00000035973; ENSMUSP00000041190; ENSMUSG00000036782 [Q80TF4-3]
ENSMUST00000115313; ENSMUSP00000110968; ENSMUSG00000036782 [Q80TF4-5]
ENSMUST00000115316; ENSMUSP00000110971; ENSMUSG00000036782 [Q80TF4-4]
ENSMUST00000115317; ENSMUSP00000110972; ENSMUSG00000036782 [Q80TF4-1]
ENSMUST00000115319; ENSMUSP00000110974; ENSMUSG00000036782 [Q80TF4-2]
GeneIDi67455
KEGGimmu:67455
UCSCiuc009sut.1 mouse [Q80TF4-2]
uc009suu.1 mouse [Q80TF4-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKLH13_MOUSE
AccessioniPrimary (citable) accession number: Q80TF4
Secondary accession number(s): A2AL86
, A2AL87, A2AL88, A2AL89, Q9DBY7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: June 16, 2009
Last modified: March 28, 2018
This is version 129 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health