Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 13

Gene

Klhl13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 13
Alternative name(s):
BTB and kelch domain-containing protein 2
Gene namesi
Name:Klhl13
Synonyms:Bklhd2, Kiaa1309
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1914705. Klhl13.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 654654Kelch-like protein 13PRO_0000119116Add
BLAST

Proteomic databases

MaxQBiQ80TF4.
PaxDbiQ80TF4.
PRIDEiQ80TF4.

PTM databases

iPTMnetiQ80TF4.
PhosphoSiteiQ80TF4.

Expressioni

Gene expression databases

BgeeiQ80TF4.
CleanExiMM_KLHL13.
GenevisibleiQ80TF4. MM.

Interactioni

Subunit structurei

Component of the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, at least composed of CUL3, KLHL9, KLHL13 and RBX1. Interacts with AURKB (By similarity).By similarity

Protein-protein interaction databases

IntActiQ80TF4. 1 interaction.
STRINGi10090.ENSMUSP00000041190.

Structurei

3D structure databases

ProteinModelPortaliQ80TF4.
SMRiQ80TF4. Positions 68-314, 340-628.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini91 – 16070BTBPROSITE-ProRule annotationAdd
BLAST
Domaini195 – 296102BACKAdd
BLAST
Repeati340 – 38849Kelch 1Add
BLAST
Repeati389 – 44052Kelch 2Add
BLAST
Repeati441 – 48747Kelch 3Add
BLAST
Repeati489 – 53446Kelch 4Add
BLAST
Repeati536 – 58651Kelch 5Add
BLAST
Repeati587 – 63549Kelch 6Add
BLAST

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 6 Kelch repeats.Curated

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118825.
HOGENOMiHOG000231583.
HOVERGENiHBG106526.
InParanoidiQ80TF4.
KOiK10447.
OMAiTEVDKYI.
OrthoDBiEOG7VTDMJ.
PhylomeDBiQ80TF4.
TreeFamiTF328485.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 5 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q80TF4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLKWKTSSP AIWKFPVPVL KTSRSTPLSP AYISLVEEED QHLKLCLGSE
60 70 80 90 100
MGLSSHLQSC KAGSTRIFTS NSHSSVVLQG FDQLRLDGLL CDVTLMPGDT
110 120 130 140 150
DDAYPVHRVM MASASDYFKA MFTGGMKEQE LMCIKLHGVS RVGLRKIIDF
160 170 180 190 200
IYTAKLSLNM DTLQDTLEAA SFLQILPVLD FCKVFLISGV TLDNCVEVGR
210 220 230 240 250
IANTYHLTEV DKYVNSFVLK NFAALLSTGE FLKLPFERLA FVLSSNSLKR
260 270 280 290 300
CTELDLFKAT CRWLRLEEPR MDVAAKLMKN IRFPLMTPQE LINYVQTVDF
310 320 330 340 350
MRTDNTCVNL LLEASNYQMM PFMQPVMQSD RTAIRSDTTR LVTLGGVLRQ
360 370 380 390 400
QLVVSKELRM YDEKTHEWKS LAPMDAPRYQ HGIAVIGNFL YVVGGQSNYD
410 420 430 440 450
TKGKTAVDTV FRFDPRYNKW IQVASLNEKR TFFHLSALKG FLYAVGGRNA
460 470 480 490 500
AGELPTVECY NPRTNEWTYV AKMNEPHYGH AGTVYGGVMY ISGGITHDTF
510 520 530 540 550
QKELMCFDPD TDKWTQKAPM TTVRGLHCMC TVGDRLYVIG GNHFRGTSDY
560 570 580 590 600
DDVLSCEYYS PILDQWTPIA SMLRGQSDVG VAVFENKIYV VGGYSWNNRC
610 620 630 640 650
MVEIVQKYDP EKNEWHKVFD LPESLGGIRA CTLTVYPPEE ATPSPSRESP

LSGP
Length:654
Mass (Da):73,787
Last modified:June 16, 2009 - v3
Checksum:i33E8497FEF1571D2
GO
Isoform 2 (identifier: Q80TF4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MLRFISHLYCCSSKEECSEDDKCILSR

Show »
Length:648
Mass (Da):73,255
Checksum:i16D6390BD932D6FD
GO
Isoform 3 (identifier: Q80TF4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MDILHRGELVAAILRNR

Show »
Length:638
Mass (Da):72,036
Checksum:i8F302FC2DF961AFF
GO
Isoform 4 (identifier: Q80TF4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MEGEYFFEENPFLEFLLKL

Show »
Length:640
Mass (Da):72,454
Checksum:i7678E0E4D2764598
GO
Isoform 5 (identifier: Q80TF4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.

Show »
Length:604
Mass (Da):68,165
Checksum:i084944B636C1C74B
GO

Sequence cautioni

The sequence BAC65773.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050Missing in isoform 5. CuratedVSP_037534Add
BLAST
Alternative sequencei1 – 3333MPLKW…SPAYI → MLRFISHLYCCSSKEECSED DKCILSR in isoform 2. 1 PublicationVSP_037535Add
BLAST
Alternative sequencei1 – 3333MPLKW…SPAYI → MDILHRGELVAAILRNR in isoform 3. 1 PublicationVSP_037536Add
BLAST
Alternative sequencei1 – 3333MPLKW…SPAYI → MEGEYFFEENPFLEFLLKL in isoform 4. CuratedVSP_037537Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122491 mRNA. Translation: BAC65773.1. Different initiation.
AK004677 mRNA. Translation: BAB23465.1.
AL773552 Genomic DNA. Translation: CAM13384.1.
AL773552 Genomic DNA. Translation: CAM13385.1.
AL773552 Genomic DNA. Translation: CAM13386.1.
AL773552 Genomic DNA. Translation: CAM13387.1.
CCDSiCCDS40891.1. [Q80TF4-3]
CCDS72348.1. [Q80TF4-2]
CCDS81105.1. [Q80TF4-4]
RefSeqiNP_001277405.1. NM_001290476.2. [Q80TF4-2]
NP_001297395.1. NM_001310466.1. [Q80TF4-4]
NP_080443.1. NM_026167.4. [Q80TF4-3]
XP_011245791.1. XM_011247489.1. [Q80TF4-1]
XP_011245793.1. XM_011247491.1. [Q80TF4-3]
XP_011245794.1. XM_011247492.1. [Q80TF4-3]
XP_011245795.1. XM_011247493.1. [Q80TF4-3]
XP_011245796.1. XM_011247494.1. [Q80TF4-3]
UniGeneiMm.224306.

Genome annotation databases

EnsembliENSMUST00000035973; ENSMUSP00000041190; ENSMUSG00000036782. [Q80TF4-3]
ENSMUST00000115313; ENSMUSP00000110968; ENSMUSG00000036782. [Q80TF4-5]
ENSMUST00000115316; ENSMUSP00000110971; ENSMUSG00000036782. [Q80TF4-4]
ENSMUST00000115317; ENSMUSP00000110972; ENSMUSG00000036782. [Q80TF4-1]
ENSMUST00000115319; ENSMUSP00000110974; ENSMUSG00000036782. [Q80TF4-2]
GeneIDi67455.
KEGGimmu:67455.
UCSCiuc009sut.1. mouse. [Q80TF4-2]
uc009suu.1. mouse. [Q80TF4-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122491 mRNA. Translation: BAC65773.1. Different initiation.
AK004677 mRNA. Translation: BAB23465.1.
AL773552 Genomic DNA. Translation: CAM13384.1.
AL773552 Genomic DNA. Translation: CAM13385.1.
AL773552 Genomic DNA. Translation: CAM13386.1.
AL773552 Genomic DNA. Translation: CAM13387.1.
CCDSiCCDS40891.1. [Q80TF4-3]
CCDS72348.1. [Q80TF4-2]
CCDS81105.1. [Q80TF4-4]
RefSeqiNP_001277405.1. NM_001290476.2. [Q80TF4-2]
NP_001297395.1. NM_001310466.1. [Q80TF4-4]
NP_080443.1. NM_026167.4. [Q80TF4-3]
XP_011245791.1. XM_011247489.1. [Q80TF4-1]
XP_011245793.1. XM_011247491.1. [Q80TF4-3]
XP_011245794.1. XM_011247492.1. [Q80TF4-3]
XP_011245795.1. XM_011247493.1. [Q80TF4-3]
XP_011245796.1. XM_011247494.1. [Q80TF4-3]
UniGeneiMm.224306.

3D structure databases

ProteinModelPortaliQ80TF4.
SMRiQ80TF4. Positions 68-314, 340-628.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ80TF4. 1 interaction.
STRINGi10090.ENSMUSP00000041190.

PTM databases

iPTMnetiQ80TF4.
PhosphoSiteiQ80TF4.

Proteomic databases

MaxQBiQ80TF4.
PaxDbiQ80TF4.
PRIDEiQ80TF4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000035973; ENSMUSP00000041190; ENSMUSG00000036782. [Q80TF4-3]
ENSMUST00000115313; ENSMUSP00000110968; ENSMUSG00000036782. [Q80TF4-5]
ENSMUST00000115316; ENSMUSP00000110971; ENSMUSG00000036782. [Q80TF4-4]
ENSMUST00000115317; ENSMUSP00000110972; ENSMUSG00000036782. [Q80TF4-1]
ENSMUST00000115319; ENSMUSP00000110974; ENSMUSG00000036782. [Q80TF4-2]
GeneIDi67455.
KEGGimmu:67455.
UCSCiuc009sut.1. mouse. [Q80TF4-2]
uc009suu.1. mouse. [Q80TF4-3]

Organism-specific databases

CTDi90293.
MGIiMGI:1914705. Klhl13.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118825.
HOGENOMiHOG000231583.
HOVERGENiHBG106526.
InParanoidiQ80TF4.
KOiK10447.
OMAiTEVDKYI.
OrthoDBiEOG7VTDMJ.
PhylomeDBiQ80TF4.
TreeFamiTF328485.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

PROiQ80TF4.
SOURCEiSearch...

Gene expression databases

BgeeiQ80TF4.
CleanExiMM_KLHL13.
GenevisibleiQ80TF4. MM.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 5 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Lung.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.

Entry informationi

Entry nameiKLH13_MOUSE
AccessioniPrimary (citable) accession number: Q80TF4
Secondary accession number(s): A2AL86
, A2AL87, A2AL88, A2AL89, Q9DBY7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: June 16, 2009
Last modified: June 8, 2016
This is version 114 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.