SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z859

- LCPS_PHARH

UniProt

Q7Z859 - LCPS_PHARH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Bifunctional lycopene cyclase/phytoene synthase

Gene
crtYB, pbs
Organism
Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase). The cyclase preferentially catalyzes the symmetric cyclization of both ends of the substrate to produce dicyclic carotenoids. Beta-carotene is further processed to the acidic carotenoid astaxanthin.2 Publications

Catalytic activityi

Carotenoid psi-end group = carotenoid beta-end group.
2 geranylgeranyl diphosphate = 15-cis-phytoene + 2 diphosphate.

Pathwayi

GO - Molecular functioni

  1. geranylgeranyl-diphosphate geranylgeranyltransferase activity Source: UniProtKB
  2. intramolecular lyase activity Source: InterPro
  3. lycopene beta cyclase activity Source: UniProtKB
  4. phytoene synthase activity Source: UniProtKB

GO - Biological processi

  1. carotene biosynthetic process Source: UniProtKB
  2. carotenoid biosynthetic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Transferase

Keywords - Biological processi

Carotenoid biosynthesis

Enzyme and pathway databases

BioCyciMetaCyc:MONOMER-17247.
UniPathwayiUPA00799; UER00773.
UPA00802.

Names & Taxonomyi

Protein namesi
Recommended name:
Bifunctional lycopene cyclase/phytoene synthase
Including the following 2 domains:
Lycopene beta-cyclase (EC:5.5.1.19)
Alternative name(s):
Lycopene cyclase
Phytoene synthase (EC:2.5.1.32)
Gene namesi
Name:crtYB
Synonyms:pbs
OrganismiPhaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Taxonomic identifieri5421 [NCBI]
Taxonomic lineageiEukaryotaFungiDikaryaBasidiomycotaAgaricomycotinaTremellomycetesCystofilobasidialesCystofilobasidiaceaeXanthophyllomyces

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei9 – 2921Helical; Reviewed predictionAdd
BLAST
Transmembranei36 – 5621Helical; Reviewed predictionAdd
BLAST
Transmembranei81 – 10121Helical; Reviewed predictionAdd
BLAST
Transmembranei117 – 13721Helical; Reviewed predictionAdd
BLAST
Transmembranei157 – 17721Helical; Reviewed predictionAdd
BLAST
Transmembranei187 – 20721Helical; Reviewed predictionAdd
BLAST
Transmembranei226 – 24621Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 673673Bifunctional lycopene cyclase/phytoene synthasePRO_0000409239Add
BLAST

Expressioni

Inductioni

Down-regulated in stationary phase.2 Publications

Structurei

3D structure databases

ProteinModelPortaliQ7Z859.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 251251Lycopene beta-cyclaseAdd
BLAST
Regioni258 – 673416Phytoene synthaseAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi367 – 40539Pro-richAdd
BLAST

Sequence similaritiesi

In the N-terminal section; belongs to the lycopene beta-cyclase family.
In the C-terminal section; belongs to the phytoene/squalene synthase family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Family and domain databases

Gene3Di1.10.600.10. 3 hits.
InterProiIPR017825. Lycopene_cyclase_dom.
IPR002060. Squ/phyt_synthse.
IPR019845. Squalene/phytoene_synthase_CS.
IPR008949. Terpenoid_synth.
[Graphical view]
PfamiPF00494. SQS_PSY. 1 hit.
[Graphical view]
SUPFAMiSSF48576. SSF48576. 3 hits.
TIGRFAMsiTIGR03462. CarR_dom_SF. 2 hits.
PROSITEiPS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z859-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTALAYYQIH LIYTLPILGL LGLLTSPILT KFDIYKISIL VFIAFSATTP    50
WDSWIIRNGA WTYPSAESGQ GVFGTFLDVP YEEYAFFVIQ TVITGLVYVL 100
ATRHLLPSLA LPKTRSSALS LALKALIPLP IIYLFTAHPS PSPDPLVTDH 150
YFYMRALSLL ITPPTMLLAA LSGEYAFDWK SGRAKSTIAA IMIPTVYLIW 200
VDYVAVGQDS WSINDEKIVG WRLGGVLPIE EAMFFLLTNL MIVLGLSACD 250
HTQALYLLHG RTIYGNKKMP SSFPLITPPV LSLFFSSRPY SSQPKRDLEL 300
AVKLLEEKSR SFFVASAGFP SEVRERLVGL YAFCRVTDDL IDSPEVSSNP 350
HATIDMVSDF LTLLFGPPLH PSQPDKILSS PLLPPSHPSR PTGMYPLPPP 400
PSLSPAELVQ FLTERVPVQY HFAFRLLAKL QGLIPRYPLD ELLRGYTTDL 450
IFPLSTEAVQ ARKTPIETTA DLLDYGLCVA GSVAELLVYV SWASAPSQVP 500
ATIEEREAVL VASREMGTAL QLVNIARDIK GDATEGRFYL PLSFFGLRDE 550
SKLAIPTDWT EPRPQDFDKL LSLSPSSTLP SSNASESFRF EWKTYSLPLV 600
AYAEDLAKHS YKGIDRLPTE VQAGMRAACA SYLLIGREIK VVWKGDVGER 650
RTVAGWRRVR KVLSVVMSGW EGQ 673
Length:673
Mass (Da):74,736
Last modified:October 1, 2003 - v1
Checksum:iECAB54AF256240A2
GO
Isoform 2 (identifier: Q7Z859-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFS → MSPYLFFVLHTTHVCICV

Show »
Length:645
Mass (Da):71,643
Checksum:i72B51B9CEB84904C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti307 – 3071E → K in strain: CBS 6938 / CCRC 22365 / VKM Y-2793.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646MTALA…FIAFS → MSPYLFFVLHTTHVCICV in isoform 2. VSP_041283Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ133646 Genomic DNA. Translation: CAB51949.1.
AY174117 mRNA. Translation: AAO73816.1.
AY177204 mRNA. Translation: AAO47570.1.
DQ016503 Genomic DNA. Translation: AAY33923.1.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ133646 Genomic DNA. Translation: CAB51949.1 .
AY174117 mRNA. Translation: AAO73816.1 .
AY177204 mRNA. Translation: AAO47570.1 .
DQ016503 Genomic DNA. Translation: AAY33923.1 .

3D structure databases

ProteinModelPortali Q7Z859.
ModBasei Search...
MobiDBi Search...

Protocols and materials databases

Structural Biology Knowledgebase Search...

Enzyme and pathway databases

UniPathwayi UPA00799 ; UER00773 .
UPA00802 .
BioCyci MetaCyc:MONOMER-17247.

Family and domain databases

Gene3Di 1.10.600.10. 3 hits.
InterProi IPR017825. Lycopene_cyclase_dom.
IPR002060. Squ/phyt_synthse.
IPR019845. Squalene/phytoene_synthase_CS.
IPR008949. Terpenoid_synth.
[Graphical view ]
Pfami PF00494. SQS_PSY. 1 hit.
[Graphical view ]
SUPFAMi SSF48576. SSF48576. 3 hits.
TIGRFAMsi TIGR03462. CarR_dom_SF. 2 hits.
PROSITEi PS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Isolation and functional characterisation of a novel type of carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous."
    Verdoes J.C., Krubasik K.P., Sandmann G., van Ooyen A.J.
    Mol. Gen. Genet. 262:453-461(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION.
    Strain: CBS 6938 / CCRC 22365 / VKM Y-2793.
  2. "Alternative splicing of transcripts from crtI and crtYB genes of Xanthophyllomyces dendrorhous."
    Lodato P., Alcaino J., Barahona S., Retamales P., Cifuentes V.
    Appl. Environ. Microbiol. 69:4676-4682(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: ATCC 24230 / UCD 67-385.
  3. "Genomic organization of the structural genes controlling the astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous."
    Niklitschek M., Alcaino J., Barahona S., Sepulveda D., Lozano C., Carmona M., Marcoleta A., Martinez C., Lodato P., Baeza M., Cifuentes V.
    Biol. Res. 41:93-108(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION.
    Strain: ATCC 24230 / UCD 67-385.
  4. "The biotechnological potential of the al-2 gene from Neurospora crassa for the production of monocyclic keto hydroxy carotenoids."
    Sandmann G., Zhu C., Krubasik P., Fraser P.D.
    Biochim. Biophys. Acta 1761:1085-1092(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  5. "Expression of the carotenoid biosynthesis genes in Xanthophyllomyces dendrorhous."
    Lodato P., Alcaino J., Barahona S., Niklitschek M., Carmona M., Wozniak A., Baeza M., Jimenez A., Cifuentes V.
    Biol. Res. 40:73-84(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
    Strain: ATCC 24230 / UCD 67-385.

Entry informationi

Entry nameiLCPS_PHARH
AccessioniPrimary (citable) accession number: Q7Z859
Secondary accession number(s): Q7Z856, Q9UUQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 31, 2011
Last sequence update: October 1, 2003
Last modified: September 3, 2014
This is version 49 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programFungal Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Multifunctional enzyme

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi