Q7Z859 (LCPS_PHARH) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 38.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bifunctional lycopene cyclase/phytoene synthase | ||||
| Gene names |
| ||||
| Organism | Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous) | ||||
| Taxonomic identifier | 5421 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Fungi › Dikarya › Basidiomycota › Agaricomycotina › Tremellomycetes › Cystofilobasidiales › Cystofilobasidiaceae › Xanthophyllomyces![]() |
Protein attributes
| Sequence length | 673 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase). The cyclase preferentially catalyzes the symmetric cyclization of both ends of the substrate to produce dicyclic carotenoids. Beta-carotene is further processed to the acidic carotenoid astaxanthin. Ref.1 Ref.4 |
| Catalytic activity | Carotenoid psi-end group = carotenoid beta-end group. 2 geranylgeranyl diphosphate = 15-cis-phytoene + 2 diphosphate. |
| Pathway | |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Induction | |
| Sequence similarities | In the N-terminal section; belongs to the lycopene beta-cyclase family. In the C-terminal section; belongs to the phytoene/squalene synthase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Carotenoid biosynthesis |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Isomerase Transferase |
| Technical term | Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological_process | carotenoid biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | geranylgeranyl-diphosphate geranylgeranyltransferase activity Inferred from direct assay Ref.1. Source: UniProtKB intramolecular lyase activityInferred from electronic annotation. Source: InterPro lycopene beta cyclase activityInferred from direct assay Ref.1. Source: UniProtKB phytoene synthase activityInferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q7Z859-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q7Z859-2) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFS → MSPYLFFVLHTTHVCICV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 673 | 673 | Bifunctional lycopene cyclase/phytoene synthase | PRO_0000409239 | |||||
Regions | |||||||||
| Transmembrane | 9 – 29 | 21 | Helical; Potential | ||||||
| Transmembrane | 36 – 56 | 21 | Helical; Potential | ||||||
| Transmembrane | 81 – 101 | 21 | Helical; Potential | ||||||
| Transmembrane | 117 – 137 | 21 | Helical; Potential | ||||||
| Transmembrane | 157 – 177 | 21 | Helical; Potential | ||||||
| Transmembrane | 187 – 207 | 21 | Helical; Potential | ||||||
| Transmembrane | 226 – 246 | 21 | Helical; Potential | ||||||
| Region | 1 – 251 | 251 | Lycopene beta-cyclase | ||||||
| Region | 258 – 673 | 416 | Phytoene synthase | ||||||
| Compositional bias | 367 – 405 | 39 | Pro-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 46 | 46 | MTALA…FIAFS → MSPYLFFVLHTTHVCICV in isoform 2. | VSP_041283 | |||||
| Natural variant | 307 | 1 | E → K in strain: CBS 6938 / CCRC 22365 / VKM Y-2793. | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Isolation and functional characterisation of a novel type of carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous." Verdoes J.C., Krubasik K.P., Sandmann G., van Ooyen A.J. Mol. Gen. Genet. 262:453-461(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION. Strain: CBS 6938 / CCRC 22365 / VKM Y-2793. |
| [2] | "Alternative splicing of transcripts from crtI and crtYB genes of Xanthophyllomyces dendrorhous." Lodato P., Alcaino J., Barahona S., Retamales P., Cifuentes V. Appl. Environ. Microbiol. 69:4676-4682(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: ATCC 24230 / UCD 67-385. |
| [3] | "Genomic organization of the structural genes controlling the astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous." Niklitschek M., Alcaino J., Barahona S., Sepulveda D., Lozano C., Carmona M., Marcoleta A., Martinez C., Lodato P., Baeza M., Cifuentes V. Biol. Res. 41:93-108(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION. Strain: ATCC 24230 / UCD 67-385. |
| [4] | "The biotechnological potential of the al-2 gene from Neurospora crassa for the production of monocyclic keto hydroxy carotenoids." Sandmann G., Zhu C., Krubasik P., Fraser P.D. Biochim. Biophys. Acta 1761:1085-1092(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [5] | "Expression of the carotenoid biosynthesis genes in Xanthophyllomyces dendrorhous." Lodato P., Alcaino J., Barahona S., Niklitschek M., Carmona M., Wozniak A., Baeza M., Jimenez A., Cifuentes V. Biol. Res. 40:73-84(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. Strain: ATCC 24230 / UCD 67-385. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ133646 Genomic DNA. Translation: CAB51949.1. AY174117 mRNA. Translation: AAO73816.1. AY177204 mRNA. Translation: AAO47570.1. DQ016503 Genomic DNA. Translation: AAY33923.1. |
3D structure databases | |
| ProteinModelPortal | Q7Z859. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:MONOMER-17247. |
| UniPathway | UPA00799; UER00773. UPA00802. |
Family and domain databases | |
| Gene3D | 1.10.600.10. 3 hits. |
| InterPro | IPR017825. Lycopene_cyclase_dom. IPR002060. Squ/phyt_synthse. IPR019845. Squalene/phytoene_synthase_CS. IPR008949. Terpenoid_synth. [Graphical view] |
| Pfam | PF00494. SQS_PSY. 1 hit. [Graphical view] |
| SUPFAM | SSF48576. Terpenoid_synth. 1 hit. |
| TIGRFAMs | TIGR03462. CarR_dom_SF. 2 hits. |
| PROSITE | PS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | LCPS_PHARH | ||||||||
| Accession | Primary (citable) accession number: Q7Z859 Secondary accession number(s): Q7Z856, Q9UUQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Fungal Protein Annotation Program | ||||||||
Relevant documents
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
