Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q7Z859 (LCPS_PHARH) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 48. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Bifunctional lycopene cyclase/phytoene synthase

Including the following 2 domains:

  1. Lycopene beta-cyclase
    EC=5.5.1.19
    Alternative name(s):
    Lycopene cyclase
  2. Phytoene synthase
    EC=2.5.1.32
Gene names
Name:crtYB
Synonyms:pbs
OrganismPhaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Taxonomic identifier5421 [NCBI]
Taxonomic lineageEukaryotaFungiDikaryaBasidiomycotaAgaricomycotinaTremellomycetesCystofilobasidialesCystofilobasidiaceaeXanthophyllomyces

Protein attributes

Sequence length673 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase). The cyclase preferentially catalyzes the symmetric cyclization of both ends of the substrate to produce dicyclic carotenoids. Beta-carotene is further processed to the acidic carotenoid astaxanthin. Ref.1 Ref.4

Catalytic activity

Carotenoid psi-end group = carotenoid beta-end group.

2 geranylgeranyl diphosphate = 15-cis-phytoene + 2 diphosphate.

Pathway

Carotenoid biosynthesis; beta-carotene biosynthesis.

Carotenoid biosynthesis; phytoene biosynthesis; all-trans-phytoene from geranylgeranyl diphosphate: step 1/1.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Induction

Down-regulated in stationary phase. Ref.3 Ref.5

Sequence similarities

In the N-terminal section; belongs to the lycopene beta-cyclase family.

In the C-terminal section; belongs to the phytoene/squalene synthase family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q7Z859-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q7Z859-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFS → MSPYLFFVLHTTHVCICV

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 673673Bifunctional lycopene cyclase/phytoene synthase
PRO_0000409239

Regions

Transmembrane9 – 2921Helical; Potential
Transmembrane36 – 5621Helical; Potential
Transmembrane81 – 10121Helical; Potential
Transmembrane117 – 13721Helical; Potential
Transmembrane157 – 17721Helical; Potential
Transmembrane187 – 20721Helical; Potential
Transmembrane226 – 24621Helical; Potential
Region1 – 251251Lycopene beta-cyclase
Region258 – 673416Phytoene synthase
Compositional bias367 – 40539Pro-rich

Natural variations

Alternative sequence1 – 4646MTALA…FIAFS → MSPYLFFVLHTTHVCICV in isoform 2.
VSP_041283
Natural variant3071E → K in strain: CBS 6938 / CCRC 22365 / VKM Y-2793.

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2003. Version 1.
Checksum: ECAB54AF256240A2

FASTA67374,736
        10         20         30         40         50         60 
MTALAYYQIH LIYTLPILGL LGLLTSPILT KFDIYKISIL VFIAFSATTP WDSWIIRNGA 

        70         80         90        100        110        120 
WTYPSAESGQ GVFGTFLDVP YEEYAFFVIQ TVITGLVYVL ATRHLLPSLA LPKTRSSALS 

       130        140        150        160        170        180 
LALKALIPLP IIYLFTAHPS PSPDPLVTDH YFYMRALSLL ITPPTMLLAA LSGEYAFDWK 

       190        200        210        220        230        240 
SGRAKSTIAA IMIPTVYLIW VDYVAVGQDS WSINDEKIVG WRLGGVLPIE EAMFFLLTNL 

       250        260        270        280        290        300 
MIVLGLSACD HTQALYLLHG RTIYGNKKMP SSFPLITPPV LSLFFSSRPY SSQPKRDLEL 

       310        320        330        340        350        360 
AVKLLEEKSR SFFVASAGFP SEVRERLVGL YAFCRVTDDL IDSPEVSSNP HATIDMVSDF 

       370        380        390        400        410        420 
LTLLFGPPLH PSQPDKILSS PLLPPSHPSR PTGMYPLPPP PSLSPAELVQ FLTERVPVQY 

       430        440        450        460        470        480 
HFAFRLLAKL QGLIPRYPLD ELLRGYTTDL IFPLSTEAVQ ARKTPIETTA DLLDYGLCVA 

       490        500        510        520        530        540 
GSVAELLVYV SWASAPSQVP ATIEEREAVL VASREMGTAL QLVNIARDIK GDATEGRFYL 

       550        560        570        580        590        600 
PLSFFGLRDE SKLAIPTDWT EPRPQDFDKL LSLSPSSTLP SSNASESFRF EWKTYSLPLV 

       610        620        630        640        650        660 
AYAEDLAKHS YKGIDRLPTE VQAGMRAACA SYLLIGREIK VVWKGDVGER RTVAGWRRVR 

       670 
KVLSVVMSGW EGQ 

« Hide

Isoform 2 [UniParc].

Checksum: 72B51B9CEB84904C
Show »

FASTA64571,643

References

[1]"Isolation and functional characterisation of a novel type of carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous."
Verdoes J.C., Krubasik K.P., Sandmann G., van Ooyen A.J.
Mol. Gen. Genet. 262:453-461(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION.
Strain: CBS 6938 / CCRC 22365 / VKM Y-2793.
[2]"Alternative splicing of transcripts from crtI and crtYB genes of Xanthophyllomyces dendrorhous."
Lodato P., Alcaino J., Barahona S., Retamales P., Cifuentes V.
Appl. Environ. Microbiol. 69:4676-4682(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Strain: ATCC 24230 / UCD 67-385.
[3]"Genomic organization of the structural genes controlling the astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous."
Niklitschek M., Alcaino J., Barahona S., Sepulveda D., Lozano C., Carmona M., Marcoleta A., Martinez C., Lodato P., Baeza M., Cifuentes V.
Biol. Res. 41:93-108(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION.
Strain: ATCC 24230 / UCD 67-385.
[4]"The biotechnological potential of the al-2 gene from Neurospora crassa for the production of monocyclic keto hydroxy carotenoids."
Sandmann G., Zhu C., Krubasik P., Fraser P.D.
Biochim. Biophys. Acta 1761:1085-1092(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[5]"Expression of the carotenoid biosynthesis genes in Xanthophyllomyces dendrorhous."
Lodato P., Alcaino J., Barahona S., Niklitschek M., Carmona M., Wozniak A., Baeza M., Jimenez A., Cifuentes V.
Biol. Res. 40:73-84(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
Strain: ATCC 24230 / UCD 67-385.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ133646 Genomic DNA. Translation: CAB51949.1.
AY174117 mRNA. Translation: AAO73816.1.
AY177204 mRNA. Translation: AAO47570.1.
DQ016503 Genomic DNA. Translation: AAY33923.1.

3D structure databases

ProteinModelPortalQ7Z859.
ModBaseSearch...
MobiDBSearch...

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Enzyme and pathway databases

BioCycMetaCyc:MONOMER-17247.
UniPathwayUPA00799; UER00773.
UPA00802.

Family and domain databases

Gene3D1.10.600.10. 3 hits.
InterProIPR017825. Lycopene_cyclase_dom.
IPR002060. Squ/phyt_synthse.
IPR019845. Squalene/phytoene_synthase_CS.
IPR008949. Terpenoid_synth.
[Graphical view]
PfamPF00494. SQS_PSY. 1 hit.
[Graphical view]
SUPFAMSSF48576. SSF48576. 3 hits.
TIGRFAMsTIGR03462. CarR_dom_SF. 2 hits.
PROSITEPS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameLCPS_PHARH
AccessionPrimary (citable) accession number: Q7Z859
Secondary accession number(s): Q7Z856, Q9UUQ0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 31, 2011
Last sequence update: October 1, 2003
Last modified: July 9, 2014
This is version 48 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programFungal Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways