Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bifunctional lycopene cyclase/phytoene synthase

Gene

crtYB

Organism
Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase). The cyclase preferentially catalyzes the symmetric cyclization of both ends of the substrate to produce dicyclic carotenoids. Beta-carotene is further processed to the acidic carotenoid astaxanthin.2 Publications

Catalytic activityi

Carotenoid psi-end group = carotenoid beta-end group.
2 geranylgeranyl diphosphate = 15-cis-phytoene + 2 diphosphate.

Pathwayi: beta-carotene biosynthesis

This protein is involved in the pathway beta-carotene biosynthesis, which is part of Carotenoid biosynthesis.
View all proteins of this organism that are known to be involved in the pathway beta-carotene biosynthesis and in Carotenoid biosynthesis.

Pathwayi: phytoene biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes all-trans-phytoene from geranylgeranyl diphosphate.
Proteins known to be involved in this subpathway in this organism are:
  1. Bifunctional lycopene cyclase/phytoene synthase (crtYB)
This subpathway is part of the pathway phytoene biosynthesis, which is itself part of Carotenoid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes all-trans-phytoene from geranylgeranyl diphosphate, the pathway phytoene biosynthesis and in Carotenoid biosynthesis.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIsomerase, Multifunctional enzyme, Transferase
Biological processCarotenoid biosynthesis

Enzyme and pathway databases

BioCyciMetaCyc:MONOMER-17247
UniPathwayiUPA00799; UER00773
UPA00802

Names & Taxonomyi

Protein namesi
Recommended name:
Bifunctional lycopene cyclase/phytoene synthase
Including the following 2 domains:
Lycopene beta-cyclase (EC:5.5.1.19)
Alternative name(s):
Lycopene cyclase
Phytoene synthase (EC:2.5.1.32)
Gene namesi
Name:crtYB
Synonyms:pbs
OrganismiPhaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Taxonomic identifieri5421 [NCBI]
Taxonomic lineageiEukaryotaFungiDikaryaBasidiomycotaAgaricomycotinaTremellomycetesCystofilobasidialesMrakiaceaeXanthophyllomyces

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei9 – 29HelicalSequence analysisAdd BLAST21
Transmembranei36 – 56HelicalSequence analysisAdd BLAST21
Transmembranei81 – 101HelicalSequence analysisAdd BLAST21
Transmembranei117 – 137HelicalSequence analysisAdd BLAST21
Transmembranei157 – 177HelicalSequence analysisAdd BLAST21
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Transmembranei226 – 246HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004092391 – 673Bifunctional lycopene cyclase/phytoene synthaseAdd BLAST673

Proteomic databases

PRIDEiQ7Z859

Expressioni

Inductioni

Down-regulated in stationary phase.2 Publications

Structurei

3D structure databases

ProteinModelPortaliQ7Z859
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 251Lycopene beta-cyclaseAdd BLAST251
Regioni258 – 673Phytoene synthaseAdd BLAST416

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi367 – 405Pro-richAdd BLAST39

Sequence similaritiesi

In the N-terminal section; belongs to the lycopene beta-cyclase family.Curated
In the C-terminal section; belongs to the phytoene/squalene synthase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Family and domain databases

CDDicd00683 Trans_IPPS_HH, 1 hit
Gene3Di1.10.600.10, 2 hits
InterProiView protein in InterPro
IPR008949 Isoprenoid_synthase_dom_sf
IPR017825 Lycopene_cyclase_dom
IPR002060 Squ/phyt_synthse
IPR019845 Squalene/phytoene_synthase_CS
IPR033904 Trans_IPPS_HH
PfamiView protein in Pfam
PF00494 SQS_PSY, 1 hit
SUPFAMiSSF48576 SSF48576, 3 hits
TIGRFAMsiTIGR03462 CarR_dom_SF, 2 hits
PROSITEiView protein in PROSITE
PS01045 SQUALEN_PHYTOEN_SYN_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q7Z859-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTALAYYQIH LIYTLPILGL LGLLTSPILT KFDIYKISIL VFIAFSATTP
60 70 80 90 100
WDSWIIRNGA WTYPSAESGQ GVFGTFLDVP YEEYAFFVIQ TVITGLVYVL
110 120 130 140 150
ATRHLLPSLA LPKTRSSALS LALKALIPLP IIYLFTAHPS PSPDPLVTDH
160 170 180 190 200
YFYMRALSLL ITPPTMLLAA LSGEYAFDWK SGRAKSTIAA IMIPTVYLIW
210 220 230 240 250
VDYVAVGQDS WSINDEKIVG WRLGGVLPIE EAMFFLLTNL MIVLGLSACD
260 270 280 290 300
HTQALYLLHG RTIYGNKKMP SSFPLITPPV LSLFFSSRPY SSQPKRDLEL
310 320 330 340 350
AVKLLEEKSR SFFVASAGFP SEVRERLVGL YAFCRVTDDL IDSPEVSSNP
360 370 380 390 400
HATIDMVSDF LTLLFGPPLH PSQPDKILSS PLLPPSHPSR PTGMYPLPPP
410 420 430 440 450
PSLSPAELVQ FLTERVPVQY HFAFRLLAKL QGLIPRYPLD ELLRGYTTDL
460 470 480 490 500
IFPLSTEAVQ ARKTPIETTA DLLDYGLCVA GSVAELLVYV SWASAPSQVP
510 520 530 540 550
ATIEEREAVL VASREMGTAL QLVNIARDIK GDATEGRFYL PLSFFGLRDE
560 570 580 590 600
SKLAIPTDWT EPRPQDFDKL LSLSPSSTLP SSNASESFRF EWKTYSLPLV
610 620 630 640 650
AYAEDLAKHS YKGIDRLPTE VQAGMRAACA SYLLIGREIK VVWKGDVGER
660 670
RTVAGWRRVR KVLSVVMSGW EGQ
Length:673
Mass (Da):74,736
Last modified:October 1, 2003 - v1
Checksum:iECAB54AF256240A2
GO
Isoform 2 (identifier: Q7Z859-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFS → MSPYLFFVLHTTHVCICV

Show »
Length:645
Mass (Da):71,643
Checksum:i72B51B9CEB84904C
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti307E → K in strain: CBS 6938 / CCRC 22365 / VKM Y-2793. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0412831 – 46MTALA…FIAFS → MSPYLFFVLHTTHVCICV in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133646 Genomic DNA Translation: CAB51949.1
AY174117 mRNA Translation: AAO73816.1
AY177204 mRNA Translation: AAO47570.1
DQ016503 Genomic DNA Translation: AAY33923.1

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLCPS_PHARH
AccessioniPrimary (citable) accession number: Q7Z859
Secondary accession number(s): Q7Z856, Q9UUQ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 31, 2011
Last sequence update: October 1, 2003
Last modified: May 23, 2018
This is version 65 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programFungal Protein Annotation Program

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health