Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q7Z859

- LCPS_PHARH

UniProt

Q7Z859 - LCPS_PHARH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Bifunctional lycopene cyclase/phytoene synthase

Gene

crtYB

Organism
Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase). The cyclase preferentially catalyzes the symmetric cyclization of both ends of the substrate to produce dicyclic carotenoids. Beta-carotene is further processed to the acidic carotenoid astaxanthin.2 Publications

Catalytic activityi

Carotenoid psi-end group = carotenoid beta-end group.
2 geranylgeranyl diphosphate = 15-cis-phytoene + 2 diphosphate.

Pathwayi

GO - Molecular functioni

  1. geranylgeranyl-diphosphate geranylgeranyltransferase activity Source: UniProtKB
  2. intramolecular lyase activity Source: InterPro
  3. lycopene beta cyclase activity Source: UniProtKB
  4. phytoene synthase activity Source: UniProtKB

GO - Biological processi

  1. carotene biosynthetic process Source: UniProtKB
  2. carotenoid biosynthetic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Isomerase, Transferase

Keywords - Biological processi

Carotenoid biosynthesis

Enzyme and pathway databases

BioCyciMetaCyc:MONOMER-17247.
UniPathwayiUPA00799; UER00773.
UPA00802.

Names & Taxonomyi

Protein namesi
Recommended name:
Bifunctional lycopene cyclase/phytoene synthase
Including the following 2 domains:
Lycopene beta-cyclase (EC:5.5.1.19)
Alternative name(s):
Lycopene cyclase
Phytoene synthase (EC:2.5.1.32)
Gene namesi
Name:crtYB
Synonyms:pbs
OrganismiPhaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)
Taxonomic identifieri5421 [NCBI]
Taxonomic lineageiEukaryotaFungiDikaryaBasidiomycotaAgaricomycotinaTremellomycetesCystofilobasidialesCystofilobasidiaceaeXanthophyllomyces

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei9 – 2921HelicalSequence AnalysisAdd
BLAST
Transmembranei36 – 5621HelicalSequence AnalysisAdd
BLAST
Transmembranei81 – 10121HelicalSequence AnalysisAdd
BLAST
Transmembranei117 – 13721HelicalSequence AnalysisAdd
BLAST
Transmembranei157 – 17721HelicalSequence AnalysisAdd
BLAST
Transmembranei187 – 20721HelicalSequence AnalysisAdd
BLAST
Transmembranei226 – 24621HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 673673Bifunctional lycopene cyclase/phytoene synthasePRO_0000409239Add
BLAST

Expressioni

Inductioni

Down-regulated in stationary phase.2 Publications

Structurei

3D structure databases

ProteinModelPortaliQ7Z859.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 251251Lycopene beta-cyclaseAdd
BLAST
Regioni258 – 673416Phytoene synthaseAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi367 – 40539Pro-richAdd
BLAST

Sequence similaritiesi

In the N-terminal section; belongs to the lycopene beta-cyclase family.Curated
In the C-terminal section; belongs to the phytoene/squalene synthase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Family and domain databases

Gene3Di1.10.600.10. 3 hits.
InterProiIPR017825. Lycopene_cyclase_dom.
IPR002060. Squ/phyt_synthse.
IPR019845. Squalene/phytoene_synthase_CS.
IPR008949. Terpenoid_synth.
[Graphical view]
PfamiPF00494. SQS_PSY. 1 hit.
[Graphical view]
SUPFAMiSSF48576. SSF48576. 3 hits.
TIGRFAMsiTIGR03462. CarR_dom_SF. 2 hits.
PROSITEiPS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q7Z859-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTALAYYQIH LIYTLPILGL LGLLTSPILT KFDIYKISIL VFIAFSATTP
60 70 80 90 100
WDSWIIRNGA WTYPSAESGQ GVFGTFLDVP YEEYAFFVIQ TVITGLVYVL
110 120 130 140 150
ATRHLLPSLA LPKTRSSALS LALKALIPLP IIYLFTAHPS PSPDPLVTDH
160 170 180 190 200
YFYMRALSLL ITPPTMLLAA LSGEYAFDWK SGRAKSTIAA IMIPTVYLIW
210 220 230 240 250
VDYVAVGQDS WSINDEKIVG WRLGGVLPIE EAMFFLLTNL MIVLGLSACD
260 270 280 290 300
HTQALYLLHG RTIYGNKKMP SSFPLITPPV LSLFFSSRPY SSQPKRDLEL
310 320 330 340 350
AVKLLEEKSR SFFVASAGFP SEVRERLVGL YAFCRVTDDL IDSPEVSSNP
360 370 380 390 400
HATIDMVSDF LTLLFGPPLH PSQPDKILSS PLLPPSHPSR PTGMYPLPPP
410 420 430 440 450
PSLSPAELVQ FLTERVPVQY HFAFRLLAKL QGLIPRYPLD ELLRGYTTDL
460 470 480 490 500
IFPLSTEAVQ ARKTPIETTA DLLDYGLCVA GSVAELLVYV SWASAPSQVP
510 520 530 540 550
ATIEEREAVL VASREMGTAL QLVNIARDIK GDATEGRFYL PLSFFGLRDE
560 570 580 590 600
SKLAIPTDWT EPRPQDFDKL LSLSPSSTLP SSNASESFRF EWKTYSLPLV
610 620 630 640 650
AYAEDLAKHS YKGIDRLPTE VQAGMRAACA SYLLIGREIK VVWKGDVGER
660 670
RTVAGWRRVR KVLSVVMSGW EGQ
Length:673
Mass (Da):74,736
Last modified:October 1, 2003 - v1
Checksum:iECAB54AF256240A2
GO
Isoform 2 (identifier: Q7Z859-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFS → MSPYLFFVLHTTHVCICV

Show »
Length:645
Mass (Da):71,643
Checksum:i72B51B9CEB84904C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti307 – 3071E → K in strain: CBS 6938 / CCRC 22365 / VKM Y-2793.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646MTALA…FIAFS → MSPYLFFVLHTTHVCICV in isoform 2. 1 PublicationVSP_041283Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133646 Genomic DNA. Translation: CAB51949.1.
AY174117 mRNA. Translation: AAO73816.1.
AY177204 mRNA. Translation: AAO47570.1.
DQ016503 Genomic DNA. Translation: AAY33923.1.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133646 Genomic DNA. Translation: CAB51949.1 .
AY174117 mRNA. Translation: AAO73816.1 .
AY177204 mRNA. Translation: AAO47570.1 .
DQ016503 Genomic DNA. Translation: AAY33923.1 .

3D structure databases

ProteinModelPortali Q7Z859.
ModBasei Search...
MobiDBi Search...

Protocols and materials databases

Structural Biology Knowledgebase Search...

Enzyme and pathway databases

UniPathwayi UPA00799 ; UER00773 .
UPA00802 .
BioCyci MetaCyc:MONOMER-17247.

Family and domain databases

Gene3Di 1.10.600.10. 3 hits.
InterProi IPR017825. Lycopene_cyclase_dom.
IPR002060. Squ/phyt_synthse.
IPR019845. Squalene/phytoene_synthase_CS.
IPR008949. Terpenoid_synth.
[Graphical view ]
Pfami PF00494. SQS_PSY. 1 hit.
[Graphical view ]
SUPFAMi SSF48576. SSF48576. 3 hits.
TIGRFAMsi TIGR03462. CarR_dom_SF. 2 hits.
PROSITEi PS01045. SQUALEN_PHYTOEN_SYN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Isolation and functional characterisation of a novel type of carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous."
    Verdoes J.C., Krubasik K.P., Sandmann G., van Ooyen A.J.
    Mol. Gen. Genet. 262:453-461(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION.
    Strain: CBS 6938 / CCRC 22365 / VKM Y-2793.
  2. "Alternative splicing of transcripts from crtI and crtYB genes of Xanthophyllomyces dendrorhous."
    Lodato P., Alcaino J., Barahona S., Retamales P., Cifuentes V.
    Appl. Environ. Microbiol. 69:4676-4682(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: ATCC 24230 / UCD 67-385.
  3. "Genomic organization of the structural genes controlling the astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous."
    Niklitschek M., Alcaino J., Barahona S., Sepulveda D., Lozano C., Carmona M., Marcoleta A., Martinez C., Lodato P., Baeza M., Cifuentes V.
    Biol. Res. 41:93-108(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION.
    Strain: ATCC 24230 / UCD 67-385.
  4. "The biotechnological potential of the al-2 gene from Neurospora crassa for the production of monocyclic keto hydroxy carotenoids."
    Sandmann G., Zhu C., Krubasik P., Fraser P.D.
    Biochim. Biophys. Acta 1761:1085-1092(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  5. "Expression of the carotenoid biosynthesis genes in Xanthophyllomyces dendrorhous."
    Lodato P., Alcaino J., Barahona S., Niklitschek M., Carmona M., Wozniak A., Baeza M., Jimenez A., Cifuentes V.
    Biol. Res. 40:73-84(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
    Strain: ATCC 24230 / UCD 67-385.

Entry informationi

Entry nameiLCPS_PHARH
AccessioniPrimary (citable) accession number: Q7Z859
Secondary accession number(s): Q7Z856, Q9UUQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 31, 2011
Last sequence update: October 1, 2003
Last modified: October 29, 2014
This is version 51 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programFungal Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Multifunctional enzyme

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3